Date published: 2026-2-5

1-800-457-3801

SCBT Portrait Logo
Seach Input

Axin Antibody (2B11): sc-293190

4.7(6)
Write a reviewAsk a question

Datasheets
  • Axin Antibody (2B11) is a mouse monoclonal IgG2a κ Axin antibody, cited in 11 publications, provided at 100 µg/ml
  • raised against amino acids 643-740 of Axin of human origin
  • recommended for detection of Axin of human origin by WB, IP, IF, IHC(P) and ELISA
  • m-IgG Fc BP-HRP and m-IgG2a BP-HRP are the preferred secondary detection reagents for Axin Antibody (2B11) for WB and IHC(P) applications. These reagents are now offered in bundles with Axin Antibody (2B11) (see ordering information below).
Crispr Promo Banner

QUICK LINKS

SEE ALSO...

Axin Antibody (2B11) is a mouse monoclonal IgG2a kappa light chain antibody that detects Axin protein of human origin by western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). Anti-Axin antibody (2B11) is available as the non-conjugated format. Axin plays a crucial role in regulating the Wnt signaling pathway, which is essential for various cellular processes, including cell proliferation, differentiation, and embryonic development. By acting as a scaffold, Axin facilitates the formation of a complex that includes β-catenin, adenomatous polyposis coli (APC), and glycogen synthase kinase 3 beta (GSK-3β), promoting β-catenin degradation. This degradation prevents aberrant Wnt signaling, which can lead to uncontrolled cell growth and cancer. Axin′s structural integrity enables effective protein-protein interactions through multiple binding domains, allowing efficient partner binding in the signaling pathway. The interaction between Axin and other proteins, such as Conductin, which shares 45% identity with Axin, highlights Axin′s importance in maintaining Wnt signaling balance and its implications in tumorigenesis.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

Axin Antibody (2B11) References:

  1. The links between axin and carcinogenesis.  |  Salahshor, S. and Woodgett, JR. 2005. J Clin Pathol. 58: 225-36. PMID: 15735151
  2. Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling.  |  Huang, SM., et al. 2009. Nature. 461: 614-20. PMID: 19759537
  3. New insights into the regulation of Axin function in canonical Wnt signaling pathway.  |  Song, X., et al. 2014. Protein Cell. 5: 186-93. PMID: 24474204
  4. Emerging roles of Axin in cerebral cortical development.  |  Ye, T., et al. 2015. Front Cell Neurosci. 9: 217. PMID: 26106297
  5. Phosphorylation of axin within biomolecular condensates counteracts its tankyrase-mediated degradation.  |  Klement, K., et al. 2023. J Cell Sci. 136: PMID: 37721093
  6. R-spondin-1 induces Axin degradation via the LRP6-CK1ε axis.  |  Tan, L., et al. 2024. Cell Commun Signal. 22: 14. PMID: 38183076
  7. APC mutations disrupt β-catenin destruction complex condensates organized by Axin phase separation.  |  Zhang, D., et al. 2024. Cell Mol Life Sci. 81: 57. PMID: 38279052
  8. E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.  |  Hülsken, J., et al. 1994. J Cell Biol. 127: 2061-9. PMID: 7806582
  9. Functional interaction of beta-catenin with the transcription factor LEF-1.  |  Behrens, J., et al. 1996. Nature. 382: 638-42. PMID: 8757136
  10. The mouse Fused locus encodes Axin, an inhibitor of the Wnt signaling pathway that regulates embryonic axis formation.  |  Zeng, L., et al. 1997. Cell. 90: 181-92. PMID: 9230313
  11. beta-catenin is a target for the ubiquitin-proteasome pathway.  |  Aberle, H., et al. 1997. EMBO J. 16: 3797-804. PMID: 9233789
  12. Functional interaction of an axin homolog, conductin, with beta-catenin, APC, and GSK3beta.  |  Behrens, J., et al. 1998. Science. 280: 596-9. PMID: 9554852

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

Axin Antibody (2B11)

sc-293190
100 µg/ml
$322.00

Axin Antibody (2B11): m-IgG Fc BP-HRP Bundle

sc-540275
100 µg Ab; 10 µg BP
$361.00

Axin Antibody (2B11): m-IgG2a BP-HRP Bundle

sc-546880
100 µg Ab; 10 µg BP
$361.00

Does this antibody recognise Axin1 or Axin2?

Asked by: Anatomical Science
Thank you for the question. This antibody recognizes Axin1. It was raised against human AXIN1 amino acids 643-740 from protein accession number O15169. The Sequence was ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA.
Answered by: Technical Support Europe
Date published: 2018-01-09

Can sc-293190: Axin (2B11) monoclonal antibody be used to stain formalin-fixed, paraffin-embedded (FFPE) tissue sections?

Asked by: Trav11
Thank you for your question. Yes, sc-293190: Axin (2B11) is recommended for use in IHC with paraffin-embedded sections. We recommend performing antigen retrieval with sodium citrate buffer (pH 6) and heat. The full protocol can be found here: https://www.scbt.com/scbt/resources/protocols/immunoperoxidase-staining
Answered by: Technical Support
Date published: 2017-03-24
  • y_2026, m_1, d_23, h_8CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_2
  • loc_en_US, sid_293190, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 97ms
  • QUESTIONS, PRODUCT
Rated 4 out of 5 by from Great featureI used this antibody in ovarian cancer cells in EMT. It works very well. Good signal at the right size. Dilution used: (1/300 to 1/500)
Date published: 2018-11-22
Rated 5 out of 5 by from fluorescent ICCI got good immunofluorescent images of paraformaldehyde-fixed mouse embryonic fibloblast (MEF) cells using axin (2B11) antibody under confocal microscope. Axin is well distributed in all cytoplasm except nucleus. It works very well
Date published: 2018-02-01
Rated 4 out of 5 by from does detect endogenous Axin in HEK293Additional bands at 60,45, 30 and 15kDa when HEK293 is used
Date published: 2018-01-03
Rated 5 out of 5 by from Western blot looks niceAt dilution of 1:500, this antibody worked in overexpressed HEK cells. Although not included, we do not see a good bad in non overexpressed HEK cells loaded at 25ug lysates protein. But the immunofluoresence used at 1:50 works really well in HEK non overexpressed cells.
Date published: 2017-12-12
Rated 5 out of 5 by from specific resultThis antibody is very strong, accurate. I like it. The Axin antibody doesn't requires any optimisation,just use the dilution 1:500, It is highly specific for the targett protein.
Date published: 2017-07-22
Rated 5 out of 5 by from very efficientI am very glad that this antibody is very efficient. I used Axin antibody of 1:500 dilution in WB.,loaded 60 ug.
Date published: 2017-05-23
  • y_2026, m_1, d_23, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_6
  • loc_en_US, sid_293190, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 11ms
  • REVIEWS, PRODUCT
Axin Antibody (2B11) is rated 4.7 out of 5 by 6.
  • y_2026, m_1, d_23, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_6
  • loc_en_US, sid_293190, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 101ms
  • REVIEWS, PRODUCT