Date published: 2025-12-9

1-800-457-3801

SCBT Portrait Logo
Seach Input

secretin receptor Antibody (E-9): sc-166112

3.5(4)
Write a reviewAsk a question

Datasheets
  • secretin receptor Antibody (E-9) is a mouse monoclonal IgG1 κ secretin receptor antibody provided at 200 µg/ml
  • raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin
  • secretin receptor Antibody (E-9) is recommended for detection of secretin precursor and active peptide of human origin by WB, IP, IF and ELISA
  • Anti-secretin receptor Antibody (E-9) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • m-IgG Fc BP-HRP and m-IgG1 BP-HRP are the preferred secondary detection reagents for secretin receptor Antibody (E-9) for WB applications. These reagents are now offered in bundles with secretin receptor Antibody (E-9) (see ordering information below).

    QUICK LINKS

    SEE ALSO...

    secretin receptor Antibody (E-9) is a mouse monoclonal IgG1 kappa light chain antibody that detects the secretin receptor protein of human origin by western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), and enzyme-linked immunosorbent assay (ELISA). secretin receptor (E-9) antibody is available in both non-conjugated and various conjugated forms, including agarose, horseradish peroxidase (HRP), phycoerythrin (PE), fluorescein isothiocyanate (FITC), and multiple Alexa Fluor® conjugates. The secretin receptor plays a crucial role in regulating digestive processes, particularly in stimulating bicarbonate-rich pancreatic juice secretion, which helps neutralize gastric acid in the duodenum. This receptor is mainly found on pancreatic ductal cells and cholangiocytes, where secretin receptor (E-9) monoclonal antibody mediates the effects of secretin, a 27-amino acid hormone produced by S cells in the proximal small intestine. The interaction between secretin and its receptor promotes bicarbonate secretion and enhances bile duct secretion, helping with digestion and nutrient absorption. The gene encoding the secretin receptor is located on human chromosome 11p15.5, and changes in its signaling pathway may be linked to various gastrointestinal disorders, highlighting its importance in digestive health and potential neuroendocrine functions.

    For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

    Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

    LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

    secretin receptor Antibody (E-9) References:

    1. Human secretin (SCT): gene structure, chromosome location, and distribution of mRNA.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. The mechanism of pancreatic secretion.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Secretin: structure of the precursor and tissue distribution of the mRNA.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Structure of porcine secretin. The amino acid sequence.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. Secretin promotes osmotic water transport in rat cholangiocytes by increasing aquaporin-1 water channels in plasma membrane. Evidence for a secretin-induced vesicular translocation of aquaporin-1.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Ordering Information

    Product NameCatalog #UNITPriceQtyFAVORITES

    secretin receptor Antibody (E-9)

    sc-166112
    200 µg/ml
    $316.00

    secretin receptor Antibody (E-9): m-IgG Fc BP-HRP Bundle

    sc-527138
    200 µg Ab; 10 µg BP
    $354.00

    secretin receptor Antibody (E-9): m-IgG1 BP-HRP Bundle

    sc-532511
    200 µg Ab; 20 µg BP
    $354.00

    secretin receptor Antibody (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $416.00

    secretin receptor Antibody (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $316.00

    secretin receptor Antibody (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $330.00

    secretin receptor Antibody (E-9) PE

    sc-166112 PE
    200 µg/ml
    $343.00

    secretin receptor Antibody (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $357.00

    secretin receptor Antibody (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $357.00

    secretin receptor Antibody (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $357.00

    secretin receptor Antibody (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $357.00

    secretin receptor Antibody (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $357.00

    secretin receptor Antibody (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $357.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Asked by: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Answered by: Jiajun Z
    Date published: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Asked by: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Answered by: Tech Support Europe
    Date published: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Asked by: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Answered by: Technical Service
    Date published: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Asked by: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Answered by: Technical Support
    Date published: 2017-02-27
    • y_2025, m_12, d_5, h_10CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_en_US, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 116ms
    • QUESTIONS, PRODUCT
    Rated 1 out of 5 by from Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Date published: 2021-04-09
    Rated 4 out of 5 by from Good antibodyWorks as we expected. Tested by immunofluorescence.
    Date published: 2018-12-18
    Rated 4 out of 5 by from This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Date published: 2018-01-19
    Rated 5 out of 5 by from Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Date published: 2014-05-08
    • y_2025, m_12, d_5, h_10
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_en_US, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 45ms
    • REVIEWS, PRODUCT
    secretin receptor Antibody (E-9) is rated 3.5 out of 5 by 4.
    • y_2025, m_12, d_5, h_10
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_en_US, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 108ms
    • REVIEWS, PRODUCT