Angptl4 Antibody (A-2): sc-373761

4.5(4)

- Angptl4 Antibody (A-2) is a mouse monoclonal IgG₁ κ Angptl4 antibody, cited in 2 publications, provided at 200 µg/ml
- raised against amino acids 51-250 mapping near the N-terminus of Angptl4 of human origin
- Angptl4 Antibody (A-2) is recommended for detection of Angptl4 of human origin by WB, IP, IF and ELISA
- Anti-Angptl4 Antibody (A-2) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
- also available conjugated to Alexa Fluor^® 488, Alexa Fluor^® 546, Alexa Fluor^® 594 or Alexa Fluor^® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
- also available conjugated to Alexa Fluor^® 680 or Alexa Fluor^® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR^®Odyssey^®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
- Contact our Technical Service Department (or your local Distributor) for more information on how to receive a FREE 10 µg sample of Angptl4 (A-2): sc-373761.
- At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for Angptl4 Antibody (A-2). This work is in progress.

References:

Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis. | Kim, I., et al. 2000. Biochem J. 346 Pt 3: 603-10. PMID: 10698685
Anti-tumor effect of recombinant retroviral vector-mediated human ANGPTL4 gene transfection. | Li, KQ., et al. 2004. Chin Med J (Engl). 117: 1364-9. PMID: 15377430
Inhibition of cardiac lipoprotein utilization by transgenic overexpression of Angptl4 in the heart. | Yu, X., et al. 2005. Proc Natl Acad Sci U S A. 102: 1767-72. PMID: 15659544
Angiopoietin-like protein 4 decreases blood glucose and improves glucose tolerance but induces hyperlipidemia and hepatic steatosis in mice. | Xu, A., et al. 2005. Proc Natl Acad Sci U S A. 102: 6086-91. PMID: 15837923
Differential regulation and properties of angiopoietin-like proteins 3 and 4. | Ge, H., et al. 2005. J Lipid Res. 46: 1484-90. PMID: 15863837

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession Number	Protein Accession Number	OMIM™ Number
Human	ANGPTL4	Entrez Gene ID: 51129	19p13.2	XM_005272484, XM_005272485, NM_001039667, NM_139314, NM_016109	UniProt ID: Q9BY76	605910

Full-length Angptl4 protein sequence with immunogen highlighted:

                                        MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Download Datasheet

Protocols Online

Monoclonal antibodies for mammalian and non-mammalian protein targets represent essentially all targets covered by polyclonal antibodies. Over 8,300 of our antibodies are offered as ImmunoCruz^® conjugates which eliminates the need for a secondary antibody.

Santa Cruz Biotechnology antibodies have over 360,000 research citations. Anti-Angptl4 Antibody (A-2) has 2 citations in a variety of scientific publications.

Primary antibodies like Anti-Angptl4 Antibody (A-2) for mammalian target proteins are recommended for the detection of a range of mammalian species, primarily of mouse, rat and human species. Many mammalian antibodies are also ideal for veterinary research and reactive with ovine, porcine, caprine, feline, canine, bovine and equine protein targets. Santa Cruz Biotechnology primary monoclonal antibodies are suitable for laboratory research applications and are not intended for diagnostic or therapeutic use.

Angptl4 Antibody (A-2) Specifications

Alternate Product Name

Angiopoietin Like 4

Product Clone Name

A-2

Classification

Primary Antibody

Clonality

Monoclonal Antibody

Antibody Isotype

IgG₁ kappa light chain

Amino Acids

51-250

Epitope Target

Angptl4

Epitope Species

human

Product Reactivity/Detection

Angptl4

Species Reactivity/Detection

human

Additional Mammalian Reactivity

N/A

Additional Non-Mammalian Reactivity

N/A

Applications

WB, IP, IF, ELISA

Vialing Information

Each vial contains 200 µg IgG₁ kappa light chain in 1.0 ml of PBS with < 0.1% sodium azide and 0.1% gelatin

Research Citations

2 citations in various scientific publications

Recommended Secondary Detection Reagents

N/A

Available Conjugates/Forms

AC: Agarose AF488: Alexa Fluor^® 488 AF546: Alexa Fluor^® 546 AF594: Alexa Fluor^® 594 AF647: Alexa Fluor^® 647 AF680: Alexa Fluor^® 680 AF790: Alexa Fluor^® 790 FITC: Fluoroscein HRP: Horseradish Peroxidase PE: Phycoerythrin

Primary antibodies for non-mammalian targets are useful in detecting proteins of plant, viral, bacterial, avian, fish, yeast and invertebrates. Some examples include Drosophila, zebrafish, Xenopus, Arabidopsis, C. elegans, Clostridium, Campylobacter, Heliobacter pylori, Hepatitis, HIV, HPV, HSV, Influenza, Klebsiella, M. tuberculosis, Plasmodium, Pseudomonas, RSV, Saccharomyces cerevisiae, Salmonella, Schistosoma, Shigella and Staphylococcus.

Santa Cruz Biotechnology monoclonal antibodies can be used in assays including flow cytometry, immunoprecipitation, Western blot analysis, and immunostaining. Anti-Angptl4 Antibody (A-2) is recommended for use in the following applications: WB (Western blotting), IP (Immunoprecipitation), IF (Immunofluorescence), ELISA (Enzyme-Linked Immunosorbent Assay).

Mouse secondary antibodies, control sera and control immunoglobulins are also offered to be used in combination with our primary monoclonal antibodies.

Tissue extracts, nuclear extracts and whole cell lysates are used with Santa Cruz Biotechnology monoclonal antibodies for western blotting or immunoprecipitation positive controls. Nuclear extracts are ideal for western blot analysis or gel shift assays positive controls. Phospho-enriched whole cell lysates and tissue extracts are available for phospho-specific antibody positive controls.

Monoclonal secondary antibodies are offered in various conjugated forms, including: Biotin (B), CruzFluor™ 790, 680, 647, 594, 555, and 488, FITC, HRP, PerCP, PerCP-Cy5.5, Texas Red (TR), and TRITC (tetramethyl rhodamine isothiocyanate) (R), for research applications like Flow Cytometry (FCM), Immunofluorescence (IF), Immunohistochemistry (IHC) staining and Western Blotting (WB). Not intended for diagnostic or therapeutic use.

Affinity purified immunoglobulins (IgGs)—conjugated and unconjugated—are available as negative controls for flow cytometry (FCM), immunofluorescence (IF), immunohistochemistry (IHC), immunoprecipitation (IP) and Western Blotting (WB) applications.

Normal sera for immunohistochemistry (IHC) applications are available as neat serum for blocking reagents. The serum which is used should match the species of the secondary antibody.

The preferred Angptl4 antibody is Angptl4 Antibody (C-7): sc-373762.

What is the recommended starting dilution for Western blot for sc-373761: Angptl4 (A-2) monoclonal antibody?

Asked by: jenniferc

The recommended starting dilution for Western blot is 1:100 with a dilution range of 1:100-1:1000. This information, along with other technical specifications, is available in the recommended protocol: https://www.scbt.com/scbt/resources/protocols/western-immuno-blotting

Answered by: Technical Support

Date published: 2017-03-22

Rated 5 out of 5 by flowerflower from it also works well in mouse it works well with western blot in human. We found it also works well in mouse with western blot and IHC detection.

Date published: 2020-09-28

Rated 4 out of 5 by 鲜花多多开 from works well with western blot this product works well with western blot，no staining showed with immunofluorescence

Date published: 2019-10-11

Rated 4 out of 5 by vagabond123 from WB The band exists in macrophages and stromal cells is different by WB

Date published: 2016-12-24

Rated 5 out of 5 by CJ from Good Western Blot data of Angptl4 expression Good Western Blot data of Angptl4 expression in non-transfected and human Angptl4 transfected whole cell lysates. -SCBT QC

Date published: 2014-01-03

Choose a Store

Choose a Language

Choose a Currency