Date published: 2026-4-13

1-800-457-3801

SCBT Portrait Logo
Seach Input

secretin receptor Antikörper (E-9): sc-166112

3.5(4)
Produkt bewertenBitte stellen Sie eine Frage

Datenblätter
  • secretin receptor Antikörper E-9 ist ein monoklonales IgG1 (kappa light chain) secretin receptor Antikörper in einer Menge von 200 µg/ml
  • die gegen Aminosäuren 33-121 gerichtete Antikörper, die an der C-terminus von secretin von human Ursprungs kartiert werden,
  • secretin receptor Antikörper (E-9) ist empfohlen für die Detektion von secretin precursor and active peptide aus der Spezies human per WB, IP, IF und ELISA
  • Anti-secretin receptor Antikörper (E-9) ist erhältlich als Konjugat mit Agarose für IP; HRP für WB, IHC(P) und ELISA; und entweder mit Phycoerythrin oder FITC für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 oder Alexa Fluor® 647 für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 680 oder Alexa Fluor® 790 für WB (NIR), IF und FCM
  • m-IgG Fc BP-HRP und m-IgG1 BP-HRP sind die bevorzugten sekundären Nachweisreagenzien für secretin receptor Antikörper (E-9) for WB applications. Diese Reagenzien werden jetzt in Bündeln mit secretin receptor Antikörper (E-9) angeboten(siehe Bestellinformationen unten).
    Gene Editing Promo Banner

    Direktverknüpfungen

    Siehe auch...

    Der Secretin Rezeptor Antikörper (E-9) ist ein monoklonaler Maus IgG1 κ Secretin Rezeptor Antikörper (auch als Secretin Rezeptor Antikörper bezeichnet), der das Secretin Rezeptor Protein menschlichen Ursprungs mittels WB, IP, IF und ELISA detektiert. Der Secretin Rezeptor Antikörper (E-9) ist sowohl in der nicht konjugierten Form des Anti-Secretin Rezeptor Antikörpers als auch in mehreren konjugierten Formen des Anti-Secretin Rezeptor Antikörpers erhältlich, einschließlich Agarose, HRP, PE, FITC und mehreren Alexa Fluor® Konjugaten. Secretin ist ein 27-Aminosäure-Hormon, das von spezifischen endokrinen Zellen, S-Zellen, produziert wird, die sich in der Mukosa des proximalen Dünndarms befinden. Secretin ist bekannt als ein potenter Stimulus für die Sekretion von bikarbonatreichem Pankreassaft. Die Sekretion von Secretin wird durch die Anwesenheit eines sauren pH-Werts oder Fettsäuren im Duodenum stimuliert. Secretin wird als größerer Vorläufer synthetisiert. Die deduzierte Aminosäuresequenz umfasst ein Signalpeptid, ein aminoterminales Peptid, Secretin selbst und ein 72-Aminosäure-Karboxyterminalpeptid. Secretin stimuliert die ductale Gallensekretion, indem es direkt mit Cholangiocyten interagiert. Es stimuliert die Exozytose in Cholangiocyten, die hauptsächlich über den Wasser-Kanal Aquaporin-1 Wasser transportieren. Ein Secretin-Mangel kann bei autistischem Syndrom impliziert sein, was darauf hindeutet, dass das Hormon neben seiner Rolle bei der Verdauung auch eine neuroendokrine Funktion haben könnte. Das Gen, das Secretin codiert, wird auf dem menschlichen Chromosom 11p15.5 abgebildet.

    Ausschließlich für Forschungszwecke. Nicht für diagnostische oder therapeutische Zwecke bestimmt.

    Alexa Fluor® ist ein Markenzeichen von Molecular Probes Inc., OR., USA

    LI-COR® und Odyssey® sind Markenzeichen von LI-COR Biosciences

    secretin receptor Antikörper (E-9) Literaturhinweise:

    1. Menschliches Sekretin (SCT): Genstruktur, Chromosomenlage und Verteilung der mRNA.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. Der Mechanismus der Pankreassekretion.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Secretin: Struktur der Vorstufe und Gewebeverteilung der mRNA.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Struktur des Schweinesekretins. Die Aminosäuresequenz.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. Sekretin fördert den osmotischen Wassertransport in Cholangiozyten der Ratte durch Vergrößerung der Aquaporin-1-Wasserkanäle in der Plasmamembran. Beweise für eine Sekretin-induzierte vesikuläre Translokation von Aquaporin-1.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Bestellinformation

    ProduktKatalog #EINHEITPreisANZAHLFavoriten

    secretin receptor Antikörper (E-9)

    sc-166112
    200 µg/ml
    $322.00

    secretin receptor (E-9): m-IgG Fc BP-HRP Bundle

    sc-527138
    200 µg Ab; 10 µg BP
    $361.00

    secretin receptor (E-9): m-IgG1 BP-HRP Bundle

    sc-532511
    200 µg Ab; 20 µg BP
    $361.00

    secretin receptor Antikörper (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $424.00

    secretin receptor Antikörper (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $322.00

    secretin receptor Antikörper (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $336.00

    secretin receptor Antikörper (E-9) PE

    sc-166112 PE
    200 µg/ml
    $349.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $364.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $364.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $364.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $364.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $364.00

    secretin receptor Antikörper (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $364.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Gefragt von: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Beantwortet von: Jiajun Z
    Veröffentlichungsdatum: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Gefragt von: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Beantwortet von: Tech Support Europe
    Veröffentlichungsdatum: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Gefragt von: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Beantwortet von: Technical Service
    Veröffentlichungsdatum: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Gefragt von: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Beantwortet von: Technical Support
    Veröffentlichungsdatum: 2017-02-27
    • y_2026, m_4, d_9, h_7CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_de_DE, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 113ms
    • QUESTIONS, PRODUCT
    Rated 1 von 5 von aus Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Veröffentlichungsdatum: 2021-04-09
    Rated 4 von 5 von aus Good antibodyWorks as we expected. Tested by immunofluorescence.
    Veröffentlichungsdatum: 2018-12-18
    Rated 4 von 5 von aus This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Veröffentlichungsdatum: 2018-01-19
    Rated 5 von 5 von aus Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Veröffentlichungsdatum: 2014-05-08
    • y_2026, m_4, d_9, h_7
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_de_DE, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 15ms
    • REVIEWS, PRODUCT
    secretin receptor Antikörper (E-9) wurde bewertet mit 3.5 von 5 von 4.
    • y_2026, m_4, d_9, h_7
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_de_DE, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 109ms
    • REVIEWS, PRODUCT