Date published: 2026-3-19

1-800-457-3801

SCBT Portrait Logo
Seach Input

CAP-18 Antibody (G-1): sc-166055

5.0(3)
Write a reviewAsk a question

Datasheets
  • CAP-18 Antibody (G-1) is a mouse monoclonal IgG2a κ CAP-18 antibody, cited in 10 publications, provided at 200 µg/ml
  • raised against amino acids 6-175 mapping at the C-terminus of CAP-18 of rat origin
  • CAP-18 Antibody (G-1) is recommended for detection of CAP-18 of mouse and rat origin by WB, IP, IF and ELISA
  • Anti-CAP-18 Antibody (G-1) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • m-IgG Fc BP-HRP, m-IgG2a BP-HRP and m-IgGκ BP-HRP are the preferred secondary detection reagents for CAP-18 Antibody (G-1) for WB applications. These reagents are now offered in bundles with CAP-18 Antibody (G-1) (see ordering information below).
Crispr Promo Banner

QUICK LINKS

SEE ALSO...

CAP-18 Antibody (G-1) is a mouse monoclonal IgG2a kappa light chain antibody that detects CAP-18 of mouse and rat origin by western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), and enzyme-linked immunosorbent assay (ELISA). CAP-18 (G-1) antibody is available in both non-conjugated and various conjugated forms, including agarose, horseradish peroxidase (HRP), phycoerythrin (PE), fluorescein isothiocyanate (FITC), and multiple Alexa Fluor® conjugates. CAP-18, also known as cathelicidin antimicrobial peptide, plays a crucial role in the innate immune response by acting as an antimicrobial agent that helps to prevent infections and modulate inflammation. CAP-18 is primarily expressed in neutrophils, bone marrow, and testis, and is particularly important in inflammatory skin diseases such as psoriasis and dermatitis, where CAP-18 is found in elevated levels. CAP-18 contains the antibacterial peptide LL-37, which is known for its ability to adopt an amphipathic α-helical conformation, allowing CAP-18 to interact effectively with bacterial lipopolysaccharides and recruit immune cells to sites of infection. The presence of LL-37 in inflammatory conditions highlights CAP-18′s significance in host defense mechanisms, making anti-CAP-18 antibody (G-1) an essential tool for researchers studying antimicrobial peptides and their roles in immune responses.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

CAP-18 Antibody (G-1) References:

  1. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3.  |  Sørensen, OE., et al. 2001. Blood. 97: 3951-9. PMID: 11389039
  2. A cathelicidin family of human antibacterial peptide LL-37 induces mast cell chemotaxis.  |  Niyonsaba, F., et al. 2002. Immunology. 106: 20-6. PMID: 11972628
  3. Cathelicidin antimicrobial peptides are expressed in salivary glands and saliva.  |  Murakami, M., et al. 2002. J Dent Res. 81: 845-50. PMID: 12454100
  4. Neonatal skin in mice and humans expresses increased levels of antimicrobial peptides: innate immunity during development of the adaptive response.  |  Dorschner, RA., et al. 2003. Pediatr Res. 53: 566-72. PMID: 12612195
  5. Phylogeny, processing and expression of the rat cathelicidin rCRAMP: a model for innate antimicrobial peptides.  |  Termén, S., et al. 2003. Cell Mol Life Sci. 60: 536-49. PMID: 12737313
  6. The cathelicidins--structure, function and evolution.  |  Tomasinsig, L. and Zanetti, M. 2005. Curr Protein Pept Sci. 6: 23-34. PMID: 15638766
  7. Cathelicidin antimicrobial peptide as a serologic marker and potential pathogenic factor in antineutrophil cytoplasmic antibody-associated vasculitis.  |  Gasim, A. 2014. Arthritis Res Ther. 16: 105. PMID: 25164257
  8. Cathelicidin Antimicrobial Peptide Acts as a Tumor Suppressor in Hepatocellular Carcinoma.  |  Huang, LH., et al. 2023. Int J Mol Sci. 24: PMID: 37958632
  9. Cathelicidin antimicrobial peptide expression in neutrophils and neurons antagonistically modulates neuroinflammation.  |  Verma, SC., et al. 2024. J Clin Invest. 135: PMID: 39656548
  10. A novel murine cathelin-like protein expressed in bone marrow.  |  Popsueva, AE., et al. 1996. FEBS Lett. 391: 5-8. PMID: 8706928
  11. Identification of CRAMP, a cathelin-related antimicrobial peptide expressed in the embryonic and adult mouse.  |  Gallo, RL., et al. 1997. J Biol Chem. 272: 13088-93. PMID: 9148921
  12. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders.  |  Frohm, M., et al. 1997. J Biol Chem. 272: 15258-63. PMID: 9182550

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

CAP-18 Antibody (G-1)

sc-166055
200 µg/ml
$322.00

CAP-18 Antibody (G-1): m-IgG Fc BP-HRP Bundle

sc-528899
200 µg Ab; 10 µg BP
$361.00

CAP-18 Antibody (G-1): m-IgGκ BP-HRP Bundle

sc-521497
200 µg Ab, 40 µg BP
$361.00

CAP-18 Antibody (G-1): m-IgG2a BP-HRP Bundle

sc-547201
200 µg Ab; 10 µg BP
$361.00

CAP-18 Antibody (G-1) AC

sc-166055 AC
500 µg/ml, 25% agarose
$424.00

CAP-18 Antibody (G-1) HRP

sc-166055 HRP
200 µg/ml
$322.00

CAP-18 Antibody (G-1) FITC

sc-166055 FITC
200 µg/ml
$336.00

CAP-18 Antibody (G-1) PE

sc-166055 PE
200 µg/ml
$349.00

CAP-18 Antibody (G-1) Alexa Fluor® 488

sc-166055 AF488
200 µg/ml
$364.00

CAP-18 Antibody (G-1) Alexa Fluor® 546

sc-166055 AF546
200 µg/ml
$364.00

CAP-18 Antibody (G-1) Alexa Fluor® 594

sc-166055 AF594
200 µg/ml
$364.00

CAP-18 Antibody (G-1) Alexa Fluor® 647

sc-166055 AF647
200 µg/ml
$364.00

CAP-18 Antibody (G-1) Alexa Fluor® 680

sc-166055 AF680
200 µg/ml
$364.00

CAP-18 Antibody (G-1) Alexa Fluor® 790

sc-166055 AF790
200 µg/ml
$364.00

Is there an expected non specific band between 60-70 kDa? I have a very strong band in the area with faint or no bands near the 20-30 kDa range

Asked by: pciari
Thank you for your question. We do not expect a nonspecific band. Please contact our Technical Support department to troubleshoot the antibody. Please call (800)-457-3801 or email scbt@scbt.com
Answered by: BlakeJ
Date published: 2022-09-07

We intend to detect mCRAMP in mouse kidney tissue by western blot using this antibody. However, in the reference you suggested, CRAMP band is observed at 20KD for PMID#33468624 and #30094093, and at 28kDa for #32682918. What band is desirable to read when

Asked by: hongsang38
Thank you for your question. It would be helpful if you could call us, allowing for a more interactive discussion of this and other related questions.
Answered by: Technical Support
Date published: 2021-07-22

Hello. I would like to ask whether the CRAMP Antibody (G-1): sc-166055 recognizes C-terminal antimicrobial peptide released from precursor protein (ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE). Thank you! Piotr

Asked by: pkol
Thank you for your question. CRAMP Antibody (G-1): sc-166055 has been raised against amino acids 6-175 mapping at the C-terminus of CRAMP of rat origin. Since this amino acid range corresponds to a longer sequence than the one you have provided, it is possible that the antibody will not bind your sequence. This is a monoclonal antibody, so it only has one distinct epitope within its epitope region. Since no epitope mapping has been performed as of yet, we cannot say whether or not the antibody would recognize the sequence you reference.
Answered by: Tech Support Europe
Date published: 2020-08-28

Can CRAMP (G-1): sc-166055 monoclonal antibody be used in IF or IHC with mouse tissue or cells? Will there be non-specific staining?

Asked by: DefinitelyNotMatt
Thank you for your inquiry. The use of mouse monoclonal antibodies with mouse samples is very common and typically poses no problem. To eliminate any potential cross-reactivity of an anti-mouse secondary detection reagent, CRAMP (G-1): sc-166055 is available in a variety of direct conjugations, such as HRP, PE, FITC and AlexaFluors.
Answered by: Technical Support
Date published: 2017-02-24
  • y_2026, m_3, d_16, h_6CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_4
  • loc_en_US, sid_166055, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 100ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from very clearWonderful results with CRAMP Antibody (G-1) monoclonal antibody, this is good
Date published: 2017-05-19
Rated 5 out of 5 by from strong positive bandStrong positive band observed with CRAMP Antibody (G-1) with little to no background
Date published: 2017-01-31
Rated 5 out of 5 by from Produced nice Western blot data of CRAMPProduced nice Western blot data of CRAMP expression in CSMLO whole cell lysate. -SCBT QC
Date published: 2014-09-10
  • y_2026, m_3, d_16, h_6
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_en_US, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 19ms
  • REVIEWS, PRODUCT
CAP-18 Antibody (G-1) is rated 5.0 out of 5 by 3.
  • y_2026, m_3, d_16, h_6
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_en_US, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 107ms
  • REVIEWS, PRODUCT