Date published: 2025-10-16

1-800-457-3801

SCBT Portrait Logo
Seach Input

CEL Antibody (E-4): sc-377087

5.0(2)
Write a reviewAsk a question

Datasheets
  • CEL Antibody (E-4) is a mouse monoclonal IgG2b κ CEL antibody, cited in 1 publications, provided at 200 µg/ml
  • specific for an epitope mapping between amino acids 439-475 within an internal region of CEL of human origin
  • CEL Antibody (E-4) is recommended for detection of CEL long isoform of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including and equine and canine
  • Anti-CEL Antibody (E-4) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • m-IgG Fc BP-HRP and m-IgG2b BP-HRP are the preferred secondary detection reagents for CEL Antibody (E-4) for WB and IHC(P) applications. These reagents are now offered in bundles with CEL Antibody (E-4) (see ordering information below).

QUICK LINKS

SEE ALSO...

CEL Antibody (E-4) is a mouse monoclonal IgG2b kappa light chain antibody that detects CEL protein of mouse, rat, and human origin by western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), immunohistochemistry with paraffin-embedded sections (IHCP), and enzyme-linked immunosorbent assay (ELISA). Anti-CEL antibody (E-4) is available in both non-conjugated and various conjugated forms, including agarose, horseradish peroxidase (HRP), phycoerythrin (PE), fluorescein isothiocyanate (FITC), and multiple Alexa Fluor® conjugates. Carboxyl ester lipase (CEL), previously known as cholesterol esterase or bile salt-stimulated lipase, plays a crucial role in lipid metabolism by hydrolyzing a diverse range of substrates, including cholesteryl esters, phospholipids, lysophospholipids, ceramide, and tri-, di-, and mono-acylglycerols. CEL′s active site features a catalytic triad composed of serine, histidine, and aspartate, which is essential for enzymatic activity. CEL is predominantly produced in the pancreas and lactating mammary gland, but expression also occurs in the liver, macrophages, and vessel wall, highlighting CEL′s importance in various physiological processes. CEL (E-4) antibody has proven valuable in studying CEL′s involvement in the assembly and secretion of chylomicrons, a critical step in lipid transport and metabolism, which underscores CEL′s significance in maintaining lipid homeostasis and potential implications in atherosclerosis and other metabolic disorders.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

CEL Antibody (E-4) References:

  1. Bile salt-stimulated carboxyl ester lipase influences lipoprotein assembly and secretion in intestine: a process mediated via ceramide hydrolysis.  |  Kirby, RJ., et al. 2002. J Biol Chem. 277: 4104-9. PMID: 11733511
  2. Transcriptional regulation of the human carboxyl ester lipase gene in THP-1 monocytes: an E-box required for activation binds upstream stimulatory factors 1 and 2.  |  Bengtsson, SH., et al. 2002. Biochem J. 365: 481-8. PMID: 11945176
  3. Characterization of a VNTR polymorphism in the coding region of the CEL gene.  |  Higuchi, S., et al. 2002. J Hum Genet. 47: 213-5. PMID: 12166660
  4. Carboxyl ester lipase: structure-function relationship and physiological role in lipoprotein metabolism and atherosclerosis.  |  Hui, DY. and Howles, PN. 2002. J Lipid Res. 43: 2017-30. PMID: 12454261
  5. Liver receptor homolog 1 controls the expression of carboxyl ester lipase.  |  Fayard, E., et al. 2003. J Biol Chem. 278: 35725-31. PMID: 12853459
  6. Association between a polymorphism in the carboxyl ester lipase gene and serum cholesterol profile.  |  Bengtsson-Ellmark, SH., et al. 2004. Eur J Hum Genet. 12: 627-32. PMID: 15114370
  7. Carboxyl ester lipase expression in macrophages increases cholesteryl ester accumulation and promotes atherosclerosis.  |  Kodvawala, A., et al. 2005. J Biol Chem. 280: 38592-8. PMID: 16166077
  8. Carboxyl-ester lipase maturity-onset diabetes of the young is associated with development of pancreatic cysts and upregulated MAPK signaling in secretin-stimulated duodenal fluid.  |  Ræder, H., et al. 2014. Diabetes. 63: 259-69. PMID: 24062244
  9. A carboxyl ester lipase (CEL) mutant causes chronic pancreatitis by forming intracellular aggregates that activate apoptosis.  |  Xiao, X., et al. 2017. J Biol Chem. 292: 7744. PMID: 28500240
  10. Purification of carboxyl ester lipase from human pancreas and the amino acid sequence of the N-terminal region.  |  Wang, CS. 1988. Biochem Biophys Res Commun. 155: 950-5. PMID: 3421974
  11. Triacylglycerols containing branched palmitic acid ester of hydroxystearic acid (PAHSA) are present in the breast milk and hydrolyzed by carboxyl ester lipase.  |  Brejchova, K., et al. 2022. Food Chem. 388: 132983. PMID: 35486985
  12. Molecular cloning and expression of rabbit pancreatic cholesterol esterase.  |  Colwell, NS., et al. 1993. Biochim Biophys Acta. 1172: 175-80. PMID: 8439557

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

CEL Antibody (E-4)

sc-377087
200 µg/ml
$316.00

CEL Antibody (E-4): m-IgG Fc BP-HRP Bundle

sc-526077
200 µg Ab; 10 µg BP
$354.00

CEL Antibody (E-4): m-IgG2b BP-HRP Bundle

sc-549675
200 µg Ab; 10 µg BP
$354.00

CEL Antibody (E-4) AC

sc-377087 AC
500 µg/ml, 25% agarose
$416.00

CEL Antibody (E-4) HRP

sc-377087 HRP
200 µg/ml
$316.00

CEL Antibody (E-4) FITC

sc-377087 FITC
200 µg/ml
$330.00

CEL Antibody (E-4) PE

sc-377087 PE
200 µg/ml
$343.00

CEL Antibody (E-4) Alexa Fluor® 488

sc-377087 AF488
200 µg/ml
$357.00

CEL Antibody (E-4) Alexa Fluor® 546

sc-377087 AF546
200 µg/ml
$357.00

CEL Antibody (E-4) Alexa Fluor® 594

sc-377087 AF594
200 µg/ml
$357.00

CEL Antibody (E-4) Alexa Fluor® 647

sc-377087 AF647
200 µg/ml
$357.00

CEL Antibody (E-4) Alexa Fluor® 680

sc-377087 AF680
200 µg/ml
$357.00

CEL Antibody (E-4) Alexa Fluor® 790

sc-377087 AF790
200 µg/ml
$357.00

CEL (E-4) Neutralizing Peptide

sc-377087 P
100 µg/0.5 ml
$68.00

Since CEL lipase is a secreted protein, the literature uses two numbering systems for its amino acids (with and without the signal peptide). Could you please specify which residues "amino acids 439-475" refer to (in other words, what is sc-377087 P)?

Asked by: ag229
Thank you for your question. The epitope sequence is HPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP.
Answered by: Tech Support Europe
Date published: 2022-03-31

What application is the blocking peptide sc-377087 P appropriate for?

Asked by: Professor Griffin
Thank you for your question. The blocking peptide is intended for use as a negative control, by pre-adsorbing the mouse monoclonal antibody against the antigen. For full protocol details, please contact our Technical Services Department or view our online protocol here: https://www.scbt.com/scbt/resources/protocols/peptide-neutralization
Answered by: Technical Support
Date published: 2017-02-28
  • y_2025, m_10, d_14, h_6CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_2
  • loc_en_US, sid_377087, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 108ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Great immunoperoxidase cytoplasmic stainingGreat immunoperoxidase cytoplasmic staining in formalin fixed, paraffin-embedded human pancreas tissue. -SCBT QC
Date published: 2015-05-18
  • y_2025, m_10, d_14, h_6
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_1, tr_1
  • loc_en_US, sid_377087, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 19ms
  • REVIEWS, PRODUCT
CEL Antibody (E-4) is rated 5.0 out of 5 by 2.
  • y_2025, m_10, d_14, h_6
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_1, tr_1
  • loc_en_US, sid_377087, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 101ms
  • REVIEWS, PRODUCT