Date published: 2026-6-4

1-800-457-3801

SCBT Portrait Logo
Seach Input

gasdermin Antibody (H-6): sc-376318

4.5(4)
Write a reviewAsk a question

Datasheets
  • gasdermin Antibody (H-6) is a mouse monoclonal IgG1 κ gasdermin antibody, cited in 9 publications, provided at 200 µg/ml
  • raised against amino acids 1-196 mapping at the N-terminus of gasdermin of human origin
  • gasdermin Antibody (H-6) is recommended for detection of gasdermin A of mouse, rat and human origin by WB, IP, IF and ELISA
  • Anti-gasdermin Antibody (H-6) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to biotin for WB, IHC(P) and ELISA
  • At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for gasdermin Antibody (H-6). This work is in progress.
Gene Editing Promo Banner

QUICK LINKS

SEE ALSO...

Gasdermin Antibody (H-6) is a mouse monoclonal IgG1 kappa light chain antibody that detects gasdermin protein of mouse, rat, and human origin by western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), and enzyme-linked immunosorbent assay (ELISA). Anti-gasdermin antibody (H-6) is available in both non-conjugated and various conjugated forms, including agarose, horseradish peroxidase (HRP), phycoerythrin (PE), fluorescein isothiocyanate (FITC), and multiple Alexa Fluor® conjugates. Gasdermin, also referred to as GSDMA, GSDM, or FKSG9, is a 445 amino acid protein primarily localized to the perinuclear region of the cytoplasm and is a member of the gasdermin family. Gasdermin plays a crucial role in the induction of apoptosis and has tumor-suppressive properties, particularly in gastric cancer cells. The gene encoding gasdermin is located on human chromosome 17, a region significant due to association with key tumor suppressor genes such as p53 and BRCA1. p53 is essential for maintaining cellular genetic integrity, regulating cell fate decisions between DNA repair and apoptosis, while mutations or loss of p53 function can lead to uncontrolled cell proliferation and various cancers. BRCA1 is vital for DNA repair and is recognized as a major genetic factor in early-onset breast cancer, as well as in predispositions to ovarian, colon, prostate, and fallopian tube cancers. Understanding gasdermin′s interactions and functions in these tumor suppressor pathways highlights potential importance in cancer research and therapeutic development.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

gasdermin Antibody (H-6) References:

  1. Gasdermin (Gsdm) localizing to mouse Chromosome 11 is predominantly expressed in upper gastrointestinal tract but significantly suppressed in human gastric cancer cells.  |  Saeki, N., et al. 2000. Mamm Genome. 11: 718-24. PMID: 10967128
  2. Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon.  |  Katoh, M. and Katoh, M. 2004. Int J Oncol. 24: 757-63. PMID: 15010812
  3. Members of a novel gene family, Gsdm, are expressed exclusively in the epithelium of the skin and gastrointestinal tract in a highly tissue-specific manner.  |  Tamura, M., et al. 2007. Genomics. 89: 618-29. PMID: 17350798
  4. GASDERMIN, suppressed frequently in gastric cancer, is a target of LMO1 in TGF-beta-dependent apoptotic signalling.  |  Saeki, N., et al. 2007. Oncogene. 26: 6488-98. PMID: 17471240
  5. Distinctive expression and function of four GSDM family genes (GSDMA-D) in normal and malignant upper gastrointestinal epithelium.  |  Saeki, N., et al. 2009. Genes Chromosomes Cancer. 48: 261-71. PMID: 19051310
  6. Caspase-11 cleaves gasdermin D for non-canonical inflammasome signalling.  |  Kayagaki, N., et al. 2015. Nature. 526: 666-71. PMID: 26375259
  7. Pore-forming activity and structural autoinhibition of the gasdermin family.  |  Ding, J., et al. 2016. Nature. 535: 111-6. PMID: 27281216
  8. Pyroptosis: Gasdermin-Mediated Programmed Necrotic Cell Death.  |  Shi, J., et al. 2017. Trends Biochem Sci. 42: 245-254. PMID: 27932073
  9. Chemotherapy drugs induce pyroptosis through caspase-3 cleavage of a gasdermin.  |  Wang, Y., et al. 2017. Nature. 547: 99-103. PMID: 28459430
  10. Molecular mechanisms of gasdermin D pore-forming activity.  |  Devant, P. and Kagan, JC. 2023. Nat Immunol. 24: 1064-1075. PMID: 37277654
  11. Gasdermin and MLKL necrotic cell death effectors: Signaling and diseases.  |  Lawlor, KE., et al. 2024. Immunity. 57: 429-445. PMID: 38479360
  12. Intraepithelial mast cells drive gasdermin C-mediated type 2 immunity.  |  Yang, L., et al. 2024. Immunity. 57: 1056-1070.e5. PMID: 38614091

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

gasdermin Antibody (H-6)

sc-376318
200 µg/ml
$322.00

gasdermin Antibody (H-6) AC

sc-376318 AC
500 µg/ml, 25% agarose
$424.00

gasdermin Antibody (H-6) HRP

sc-376318 HRP
200 µg/ml
$322.00

gasdermin Antibody (H-6) FITC

sc-376318 FITC
200 µg/ml
$336.00

gasdermin Antibody (H-6) PE

sc-376318 PE
200 µg/ml
$349.00

gasdermin Antibody (H-6) Alexa Fluor® 488

sc-376318 AF488
200 µg/ml
$364.00

gasdermin Antibody (H-6) Alexa Fluor® 546

sc-376318 AF546
200 µg/ml
$364.00

gasdermin Antibody (H-6) Alexa Fluor® 594

sc-376318 AF594
200 µg/ml
$364.00

gasdermin Antibody (H-6) Alexa Fluor® 647

sc-376318 AF647
200 µg/ml
$364.00

gasdermin Antibody (H-6) Alexa Fluor® 680

sc-376318 AF680
200 µg/ml
$364.00

gasdermin Antibody (H-6) Alexa Fluor® 790

sc-376318 AF790
200 µg/ml
$364.00

gasdermin Antibody (H-6) B

sc-376318 B
200 µg/ml
$326.00

Necesito el anticuerpo para usarlo en Inmunohistquimica. Tiene disponible el anticuerpo para esa técnica?

Asked by: Anonymous
Deberá ponerse en contacto con su distribuidor local. A continuación se muestra un enlace a su información de contacto. https://www.scbt.com/resources/distributors
Answered by: Technical Service
Date published: 2024-10-11

Is the gasdermin Antibody (H-6) recommended with m-IgG Fc BP-HRP, m-IgG1 BP-HRP or m-IgGκ BP-HRP by any chance?

Asked by: Fern
Thank you for your question. At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for gasdermin Antibody (H-6). This work is in progress.
Answered by: BlakeJ
Date published: 2024-07-22

For western blots, should I dilute the primary antibody in 5% w/v nonfat dry milk, 1X TBS, 0.1% Tween® 20 or just T-TBS? Thank you

Asked by: tonytony
Thank you for your question. For blocking we recommend UltraCruz® Blocking Reagent: sc-516214. Otherwise, milk-based blocking buffers are best suited for a broad blocking effect reducing unspecific signals, or BSA-based blocking if signals are specific but comparatively faint. Contact our technical service team directly for further assistance.
Answered by: Tech Support Europe
Date published: 2023-06-14

Does the antibody recognize cleaved form of GSDMD? Such as N-term (p30) and C-term (p23)? Thanks!

Asked by: tuuu
Thank you for the question. Gasdermin is a 445 amino acid protein This clone (H-6) was raised against amino acids 1-196 mapping at the N-terminus of human Gasdermin. Epitope mapping has not been carried out for this antibody. Therefore the exact binding region within the below sequence and reactivity with cleaved GSDMDs has not been determined, yet: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVT
Answered by: Technical Support Europe
Date published: 2017-12-27

What is the recommended fixation method for immunofluorescence staining with gasdermin (H-6): sc-376318 monoclonal antibody?

Asked by: Germaine
Thank you for your inquiry. We recommend fixing cells for 5 minutes in -10°C methanol and allowing to air dry. The full protocol can be viewed here: https://www.scbt.com/scbt/resources/protocols/immunofluorescence-cell-staining
Answered by: Technical Support
Date published: 2017-02-24
  • y_2026, m_6, d_2, h_13CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.46
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_5
  • loc_en_US, sid_376318, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 98ms
  • QUESTIONS, PRODUCT
Rated 3 out of 5 by from GasderminNice antibody-Gasdermin H-6 detects 53kd band with the mouse liver lysate-1:400 dil in 5% SM.
Date published: 2017-05-19
Rated 5 out of 5 by from This is the recommended gasdermin monoclonalWorks as expected in Western blotting and Immunofluoresence on mouse, rat an human samples
Date published: 2017-02-01
Rated 5 out of 5 by from Produced excellent immunofluorescence cytoplasmicProduced excellent immunofluorescence cytoplasmic staining in methanol-fixed HeLa cells. -SCBT QC
Date published: 2015-05-01
Rated 5 out of 5 by from Produced positive Western Blot data of gasderminProduced positive Western Blot data of gasdermin expression in non-transfected and mouse gasdermin transfected 293 whole cell lysates. -SCBT QC
Date published: 2013-09-11
  • y_2026, m_6, d_3, h_11
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.46
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_en_US, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 16ms
  • REVIEWS, PRODUCT
gasdermin Antibody (H-6) is rated 4.5 out of 5 by 4.
  • y_2026, m_6, d_3, h_11
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.46
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_en_US, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 98ms
  • REVIEWS, PRODUCT