Date published: 2026-4-23

1-800-457-3801

SCBT Portrait Logo
Seach Input

VIP Antibody (H-6): sc-25347

4.9(11)
Write a reviewAsk a question

Datasheets
  • VIP Antibody (H-6) is a mouse monoclonal IgG2b κ VIP antibody, cited in 38 publications, provided at 200 µg/ml
  • raised against amino acids 1-95 of VIP of human origin
  • VIP Antibody (H-6) is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA
  • Anti-VIP Antibody (H-6) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
  • m-IgG2b BP-HRP and m-IgGκ BP-HRP are the preferred secondary detection reagents for VIP Antibody (H-6) for WB and IHC(P) applications. These reagents are now offered in bundles with VIP Antibody (H-6) (see ordering information below).
Gene Editing Promo Banner

QUICK LINKS

SEE ALSO...

VIP Antibody (H-6) is a mouse monoclonal IgG2b kappa light chain antibody engineered to detect the human vasoactive intestinal peptide (VIP), also known as PHM27 or glucagon family member. VIP monoclonal antibody (H-6) is raised against amino acids 1-95 of the VIP protein, ensuring precise binding and high affinity across various experimental techniques including western blotting (WB), immunoprecipitation (IP), immunofluorescence (IF), immunohistochemistry with paraffin-embedded sections (IHCP), and enzyme-linked immunosorbent assay (ELISA). Vasoactive intestinal peptide plays a pivotal role in smooth muscle relaxation and vasodilation, thereby regulating blood pressure and facilitating intestinal water and electrolyte secretion, which underscores its importance in cardiovascular and gastrointestinal research. Beyond its vasodilatory effects, VIP is integral to neuroprotection, immune system modulation, and exhibits anti-inflammatory properties, making VIP (H-6) antibody a key tool in diverse physiological processes and potential therapeutic applications. VIP monoclonal antibody (H-6) is available in both non-conjugated and multiple conjugated forms, including horseradish peroxidase (HRP), phycoerythrin (PE), fluorescein isothiocyanate (FITC), and various Alexa Fluor® dyes, providing flexibility for a wide range of experimental setups. Anti-VIP antibody (H-6) enables scientists to effectively study the mechanisms involving VIP and identify potential therapeutic targets for conditions related to vasodilation, immune regulation, and inflammatory responses.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

VIP Antibody (H-6) References:

  1. Differential processing of proglucagon by the subtilisin-like prohormone convertases PC2 and PC3 to generate either glucagon or glucagon-like peptide.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. Expression and functional activity of glucagon, glucagon-like peptide I, and glucose-dependent insulinotropic peptide receptors in rat pancreatic islet cells.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. Glucose intolerance but normal satiety in mice with a null mutation in the glucagon-like peptide 1 receptor gene.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. Vasoactive intestinal peptide (VIP) stimulates in vitro growth of VIP-1 receptor-bearing human pancreatic adenocarcinoma-derived cells.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. Specific features of glycogen metabolism in the liver.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. Pituitary adenylate cyclase-activating polypeptide (PACAP) 38 and PACAP27 activate common and distinct intracellular signaling pathways to stimulate growth hormone secretion from porcine somatotropes.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

VIP Antibody (H-6)

sc-25347
200 µg/ml
$322.00

VIP Antibody (H-6): m-IgGκ BP-HRP Bundle

sc-520782
200 µg Ab, 40 µg BP
$361.00

VIP Antibody (H-6): m-IgG2b BP-HRP Bundle

sc-548853
200 µg Ab; 10 µg BP
$361.00

VIP Antibody (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
$424.00

VIP Antibody (H-6) HRP

sc-25347 HRP
200 µg/ml
$322.00

VIP Antibody (H-6) FITC

sc-25347 FITC
200 µg/ml
$336.00

VIP Antibody (H-6) PE

sc-25347 PE
200 µg/ml
$349.00

VIP Antibody (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
$364.00

VIP Antibody (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
$364.00

VIP Antibody (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
$364.00

VIP Antibody (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
$364.00

VIP Antibody (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
$364.00

VIP Antibody (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
$364.00

Can you take a picture of the product‘s package? Can' t find it after cleaning the lab...

Asked by: Anonymous
Thank you for your question. Please contact our Technical Service Department. Our Asian Technical Service team is available at (+86) 021-60936350 or asia@scbio.cn or by live chat on our website.
Answered by: Sen Li
Date published: 2026-01-30

Hi, does this antibody work with IHC on free floating sections from mouse?

Asked by: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email scbt@scbt.com.
Answered by: BlakeJ
Date published: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Asked by: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Answered by: Tech Support Europe
Date published: 2021-09-13

Did you test this antibody in flowcytometry ?

Asked by: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Answered by: Tech Service
Date published: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Asked by: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Answered by: Tech Service
Date published: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Asked by: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Answered by: Technical Support
Date published: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Asked by: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Answered by: SCBT Heidelberg Support
Date published: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Asked by: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Answered by: Technical Support Europe
Date published: 2018-01-10
  • y_2026, m_4, d_20, h_8CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_9
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 102ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Date published: 2024-11-07
Rated 5 out of 5 by from Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Date published: 2023-02-02
Rated 5 out of 5 by from It looked greatI ordered this a month ago and it worked great! I will purchase again
Date published: 2018-05-04
Rated 5 out of 5 by from Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date published: 2018-01-31
Rated 5 out of 5 by from GoodThe analysis results of WB were very stong and clear, it worked well for WB
Date published: 2017-06-08
Rated 5 out of 5 by from Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date published: 2017-01-11
Rated 4 out of 5 by from Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date published: 2015-07-08
Rated 5 out of 5 by from Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date published: 2015-06-02
  • y_2026, m_4, d_20, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 16ms
  • REVIEWS, PRODUCT
VIP Antibody (H-6) is rated 4.9 out of 5 by 11.
  • y_2026, m_4, d_20, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 95ms
  • REVIEWS, PRODUCT