Date published: 2026-9-3

1-800-457-3801

SCBT Portrait Logo
Seach Input

Anticorpo secretin (E-9): sc-166112

3.5(4)
Scrivi una recensioneFai una domanda

Schede Tecniche
  • secretin Antibody E-9 è un monoclonale di topo IgG1 (kappa light chain) secretin antibody fornito in 200 µg/ml
  • sensibilizzato contro gli amminoacidi 33-121 che si trovano all'interno di un dominio extracellulare N-terminal di secretin di origine human
  • secretin Antibody (E-9) é raccomandato per il rilevamento di secretin di origine human in WB, IP, IF e ELISA
  • secretin Antibody (E-9) é disponibile coniugato con agarose per IP; HRP per WB, IHC(P) ed ELISA; sia con phycoerythrin o FITC per IF, IHC(P) e FCM
  • disponibile anche coniugato con Alexa Fluor® 488, Alexa Fluor® 546; Alexa Fluor® 594 o Alexa Fluor® 647 per IF, IHC (P) e FCM
  • disponibile anche coniugato con Alexa Fluor® 680 o Alexa Fluor® 790 per WB (NIR), IF e FCM
  • m-IgG Fc BP-HRP e m-IgG1 BP-HRP sono i reagenti secondari preferiti per l'anticorpo secretin (E-9) for WB applications. Questi reagenti sono ora offerti in bundle con l'anticorpo secretin (E-9)(vedere le informazioni per l'ordine sotto).
    Gene Editing Promo Banner

    LINK RAPIDI

    VEDI ANCHE...

    Solo per ricerca in vitro. Non destinato ad uso Diagnostico o Terapeutico.

    Alexa Fluor® è un marchio registrato di Molecular Probes Inc., OR., USA

    LI-COR® e Odyssey® sono marchi registrati di LI-COR Biosciences

    Anticorpo secretin (E-9) Riferimenti:

    1. Secretina umana (SCT): struttura del gene, localizzazione cromosomica e distribuzione dell'mRNA.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. Il meccanismo della secrezione pancreatica.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Secretina: struttura del precursore e distribuzione tissutale dell'mRNA.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Struttura della secretina suina. La sequenza aminoacidica.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. La secretina promuove il trasporto osmotico di acqua nei colangiociti di ratto aumentando i canali idrici dell'acquaporina-1 nella membrana plasmatica. Evidenza di una traslocazione vescicolare di acquaporina-1 indotta dalla secretina.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Informazioni ordini

    Nome del prodottoCodice del prodottoUNITÀPrezzoQuantitàPreferiti

    secretin Anticorpo (E-9)

    sc-166112
    200 µg/ml
    $322.00

    secretin (E-9): m-IgG Fc BP-HRP Bundle

    sc-527138
    200 µg Ab; 10 µg BP
    $361.00

    secretin (E-9): m-IgG1 BP-HRP Bundle

    sc-532511
    200 µg Ab; 20 µg BP
    $361.00

    secretin Anticorpo (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $424.00

    secretin Anticorpo (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $322.00

    secretin Anticorpo (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $336.00

    secretin Anticorpo (E-9) PE

    sc-166112 PE
    200 µg/ml
    $349.00

    secretin Anticorpo (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $364.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Richiesta da: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Risposta da: Jiajun Z
    Data di pubblicazione: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Richiesta da: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Risposta da: Tech Support Europe
    Data di pubblicazione: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Richiesta da: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Risposta da: Technical Service
    Data di pubblicazione: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Richiesta da: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Risposta da: Technical Support
    Data di pubblicazione: 2017-02-27
    • y_2026, m_9, d_3, h_9CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_it_IT, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 157ms
    • QUESTIONS, PRODUCT
    Rated 1 di 5 di da Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Data di pubblicazione: 2021-04-09
    Rated 4 di 5 di da Good antibodyWorks as we expected. Tested by immunofluorescence.
    Data di pubblicazione: 2018-12-18
    Rated 4 di 5 di da This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Data di pubblicazione: 2018-01-19
    Rated 5 di 5 di da Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Data di pubblicazione: 2014-05-08
    • y_2026, m_9, d_3, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_it_IT, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 9ms
    • REVIEWS, PRODUCT
    Anticorpo secretin receptor (E-9) valutazione 3.5 di 5 di 4.
    • y_2026, m_9, d_3, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_it_IT, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 111ms
    • REVIEWS, PRODUCT