Date published: 2026-9-3

1-800-457-3801

SCBT Portrait Logo
Seach Input

secretin Anticorpo (E-9): sc-166112

3.5(4)
Escrever uma avaliaçãoFazer uma pergunta

Fichas de dados
  • secretin Anticorpo E-9é um anticorpo monoclonal produzido em camundongo IgG1 (kappa light chain) secretin anticorpo fornecido em 200 µg/ml
  • activada contra o mapeamento de aminoácidos 33-121 dentro de um domínio extracelular N-terminal de secretin de origem human
  • secretin Anticorpo (E-9) é recomendado para a detecção de secretin of human origin by WB, IP, IF and ELISA
  • Anticorpo anti-secretin O anticorpo anti-secretin (E-9) está disponível conjugado com agarose para IP; HRP para WB, IHC(P) e ELISA; e com fioeritrina ou FITC para IF, IHC(P) e FCM
  • também disponível conjugado com Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 ou Alexa Fluor® 647 para WB (RGB), IF, IHC(P) e FCM, e para utilização com sistemas de imagiologia fluorescente RGB, tais como iBright™ FL1000, FluorChem™, Typhoon, Azure e outros sistemas comparáveis
  • também disponível conjugado com Alexa Fluor® 680 ou Alexa Fluor® 790 para WB (NIR), IF e FCM; para utilização com sistemas de deteção de infravermelhos próximos (NIR), tais como LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure e outros sistemas comparáveis
  • m-IgG Fc BP-HRP e m-IgG1 BP-HRP são os reagentes de deteção secundários preferidos para secretin Antibody (E-9) for WB applications. Estes reagentes são agora oferecidos em conjuntos com secretin Antibody (E-9)(ver informações de encomenda abaixo).
    Gene Editing Promo Banner

    LINKS RÁPIDOS

    VEJA TAMBÉM

    Para uso em exclusivo em pesquisa. Não se destina a uso em diagnostico e tratamento.

    Alexa Fluor® é uma marca comercial da Molecular Probes Inc., OR., EUA

    LI-COR® e Odyssey® são marcas registadas da LI-COR Biosciences

    Referencias do secretin Anticorpo (E-9):

    1. Secretina humana (SCT): estrutura do gene, localização cromossómica e distribuição do ARNm.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. O mecanismo da secreção pancreática.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Secretina: estrutura do precursor e distribuição tecidual do mRNA.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Estrutura da secretina porcina. A sequência de aminoácidos.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. A secretina promove o transporte osmótico de água em colangiócitos de rato através do aumento dos canais de água aquaporina-1 na membrana plasmática. Evidência de uma translocação vesicular induzida pela secretina da aquaporina-1.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Informacoes sobre ordens

    Nome do ProdutoNumero de CatalogoUNIDPrecoQdeFAVORITOS

    secretin Anticorpo (E-9)

    sc-166112
    200 µg/ml
    $322.00

    Pacote do secretin (E-9): m-IgG Fc BP-HRP

    sc-527138
    200 µg Ab; 10 µg BP
    $361.00

    Pacote do secretin (E-9): m-IgG1 BP-HRP

    sc-532511
    200 µg Ab; 20 µg BP
    $361.00

    secretin Anticorpo (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $424.00

    secretin Anticorpo (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $322.00

    secretin Anticorpo (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $336.00

    secretin Anticorpo (E-9) PE

    sc-166112 PE
    200 µg/ml
    $349.00

    secretin Anticorpo (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $364.00

    secretin Anticorpo (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $364.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Asked by: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Answered by: Jiajun Z
    Date published: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Asked by: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Answered by: Tech Support Europe
    Date published: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Asked by: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Answered by: Technical Service
    Date published: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Asked by: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Answered by: Technical Support
    Date published: 2017-02-27
    • y_2026, m_9, d_3, h_9CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_pt_PT, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 119ms
    • QUESTIONS, PRODUCT
    Rated 1 out of 5 by from Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Date published: 2021-04-09
    Rated 4 out of 5 by from Good antibodyWorks as we expected. Tested by immunofluorescence.
    Date published: 2018-12-18
    Rated 4 out of 5 by from This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Date published: 2018-01-19
    Rated 5 out of 5 by from Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Date published: 2014-05-08
    • y_2026, m_9, d_3, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_pt_PT, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 19ms
    • REVIEWS, PRODUCT
    secretin receptor Anticorpo (E-9) is rated 3.5 out of 5 by 4.
    • y_2026, m_9, d_3, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_pt_PT, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 119ms
    • REVIEWS, PRODUCT