Date published: 2026-4-5

1-800-457-3801

SCBT Portrait Logo
Seach Input

PXDN Antibody (2C11): sc-293408

5.0(1)
Write a reviewAsk a question

Datasheets
  • PXDN Antibody (2C11) is a mouse monoclonal IgG2b κ PXDN antibody, cited in 2 publications, provided at 100 µg/ml
  • raised against amino acids 1452-1561 of PXDN of human origin
  • recommended for detection of PXDN of human origin by WB, IP and ELISA
  • At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for PXDN Antibody (2C11). This work is in progress.
Gene Editing Promo Banner

QUICK LINKS

SEE ALSO...

PXDN Antibody (2C11) is a mouse monoclonal IgG2b kappa light chain antibody that detects the PXDN protein of human origin by western blotting (WB), immunoprecipitation (IP), and enzyme-linked immunosorbent assay (ELISA). Anti-PXDN antibody (2C11) is available as the non-conjugated format. PXDN, or peroxidasin homolog, is a significant 1,479 amino acid secreted protein that plays a crucial role in the formation of the extracellular matrix, which is essential for tissue structure and function. PXDN shows predominant expression in the heart, lung, ovary, spleen, intestine, and placenta, while showing lower expression levels in the liver, colon, pancreas, kidney, thymus, skeletal muscle, and prostate. PXDN involvement in the stabilization and remodeling of the extracellular matrix is vital for maintaining tissue integrity and facilitating cellular communication. Structurally, PXDN belongs to the peroxidase family and the XPO subfamily, featuring four immunoglobulin-like C2-type domains, four leucine-rich repeats, one LRRCT domain, one LRRNT domain, and a VWFC domain. PXDN may exist as two alternative isoforms and can form a homotrimer, showcasing a unique hybrid structure that combines an enzymatically functional peroxidase domain with motifs typically associated with extracellular matrix proteins. This multifaceted role and structure underscore PXDN significance in various biological processes and potential implications in health and disease.

For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Alexa Fluor® is a trademark of Molecular Probes Inc., OR., USA

LI-COR® and Odyssey® are registered trademarks of LI-COR Biosciences

PXDN Antibody (2C11) References:

  1. Isolation of differentially expressed cDNAs from p53-dependent apoptotic cells: activation of the human homologue of the Drosophila peroxidasin gene.  |  Horikoshi, N., et al. 1999. Biochem Biophys Res Commun. 261: 864-9. PMID: 10441517
  2. A novel melanoma gene (MG50) encoding the interleukin 1 receptor antagonist and six epitopes recognized by human cytolytic T lymphocytes.  |  Mitchell, MS., et al. 2000. Cancer Res. 60: 6448-56. PMID: 11103812
  3. Identification and characterization of VPO1, a new animal heme-containing peroxidase.  |  Cheng, G., et al. 2008. Free Radic Biol Med. 45: 1682-94. PMID: 18929642
  4. Peroxidasin is secreted and incorporated into the extracellular matrix of myofibroblasts and fibrotic kidney.  |  Péterfi, Z., et al. 2009. Am J Pathol. 175: 725-35. PMID: 19590037
  5. Assignment of a human melanoma associated gene MG50 (D2S448) to chromosome 2p25.3 by fluorescence in situ hybridization.  |  Weiler, SR., et al. 1994. Genomics. 22: 243-4. PMID: 7959781
  6. Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.  |  Nagase, T., et al. 1996. DNA Res. 3: 321-9, 341-54. PMID: 9039502

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

PXDN Antibody (2C11)

sc-293408
100 µg/ml
$322.00

I am interested in Anti-PXDN Antibody (2C11): sc-293408. According to your specification 2C11 was raised against aa residues 1452-1561. However, hPXDN only has 1479 amino acid residues. Can you please confirm the sequence 2C11 was raised against. Thanks.

Asked by: Anonymous
Thank you for your question. This seems to be based on an older characterisation of the protein. The actual epitope sequence of this antibody is STSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESR which corresponds to amino acids 1369-1409.
Answered by: Tech Support Europe
Date published: 2022-02-04

Abnova sells and recommends PXDN monoclonal Ab, clone 2C11, for WB and ELISA. Is it the same Ab that you sell?

Asked by: Ser_01
Thank you for your question. PXDN (2C11) is a commercially available clone that many antibody suppliers provide.
Answered by: Tech Service
Date published: 2019-09-06

Do you have any data to show that this antibody detects native PXDN from human cells? The supporting data shown only shows detection of a recombinant protein.

Asked by: cholley
Thank you for your question. The only data we have for this antibody is on recombinant protein, but we do expect and warranty this antibody to detect endogenously expressed PXDN of human origin. Please contact Technical Service by phone, (800)-457-3801 option 2, email <scbt@scbt.com>, or by live chat directly on our website, www.scbt.com if you have any further questions.
Answered by: Tech Service
Date published: 2018-11-30

For Western Blot, is it recommended to use denatured or non-denatured conditions with PXDN (2C11): sc-293408 antibody?

Asked by: AbPolly
Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
Answered by: Technical Support
Date published: 2022-05-22
  • y_2026, m_3, d_26, h_7CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_4
  • loc_en_US, sid_293408, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 104ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Good for Western blotAntibody works for Western blot with Ishikawa cell lysates in published research -SCBT QC
Date published: 2023-09-14
  • y_2026, m_3, d_26, h_7
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_293408, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 9ms
  • REVIEWS, PRODUCT
PXDN Antibody (2C11) is rated 5.0 out of 5 by 1.
  • y_2026, m_3, d_26, h_7
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_293408, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 97ms
  • REVIEWS, PRODUCT