Neuropeptide YA potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels

Neuropeptide Y (CAS 90880-35-6)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 69ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Synonym: NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Application: A potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
CAS Number: 90880-35-6
Purity: >97% pure by HPLC
Molecular Weight: 4271.7
Molecular Formula: C189H285N55O57S
* Refer to Certificate of Analysis for lot specific data (including water content).
Submit a review for this product and receive 15 CruzCredits

Neuropeptide Y is a biologically active peptide. A synthetic potassium channel blocker. A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells. Reactive with various species, including cow and pig.

Usage :
Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Sequence :
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Storage :
Store at -20° C
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Download SDS (MSDS)

Certificate of Analysis

Adobe Acrobat Reader is required to reliably view,
print and comment on PDF documents

Neuropeptide Y  Product Citations

See how others have used Neuropeptide Y. Click on the entry to view the PubMed entry .

Citations 1 to 4 of 4 total

PMID: # 27069867  2016. Molecular metabolism. 5: 271-82.

PMID: # 22249165  2012. EMBO reports. 13: 258-65.

PMID: # 21914774  2011. Endocrinology. 152: 4138-47.

PMID: # 17785501  2007. American journal of physiology. Endocrinology and metabolism. 293: E1335-40.

Citations 1 to 4 of 4 total
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 62ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 74ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;

Santa Cruz Biotechnology, Inc. is a world leader in the development of products for the biomedical research market. Call us Toll Free at 1-800-457-3801.
Copyright © 2007-2019 Santa Cruz Biotechnology, Inc. All Rights Reserved. "Santa Cruz Biotechnology", and the Santa Cruz Biotechnology, Inc. logo, "Santa Cruz Animal Health", "San Juan Ranch", "Supplement of Champions", the San Juan Ranch logo, "Ultracruz", "Chemcruz", "Immunocruz", "Exactacruz", and "EZ Touch" are registered trademarks of Santa Cruz Biotechnology, Inc.
All trademarks are the property of their respective owners.