Date published: 2025-9-8

001 800-1338-3838

SCBT Portrait Logo
Seach Input

secretin receptor 항체 (E-9): sc-166112

3.5(4)
리뷰 쓰기질문하기

데이터 시트
  • secretin receptor 항체 E-9 는 마우스 monoclonal IgG1 (kappa light chain) secretin receptor 항체 이며 200 µg/ml으로 제공합니다.
  • 아미노산 33-121에 대해 제기됨 secretin의 C-terminus에 매핑됨 마우스와 human의 기원
  • secretin receptor 항체 (E-9)는 WB, IP, IF and ELISA으로 human유래의 secretin precursor and active peptide 를 감지하는 데에 추천한다 .
  • 항-secretin receptor 항체(E-9)는 IP용 agarose와 결합되어 이용 가능하며, WB, IHC(P), ELISA용 HRP와 결합되어 이용 가능하며, IF, IHC(P), FCM용 phycoerythrin 또는 FITC와 결합되어 이용 가능합니다.
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • secretin receptor (E-9): sc-166112무료10 µg 샘플을 신청하려면 기술지원팀 (또는 로컬 디스트리뷰터)에 연락주세요.
  • m-IgG Fc BP-HRP1 BP-HRP">m-IgG1 BP-HRP 는 secretin receptor 항체 (E-9) for WB applications. 이 시약은 이제 secretin receptor 항체 (E-9)와 함께 번들로 제공됩니다(아래 주문 정보 참조).

    빠른 링크

    더보기

    세크레틴 수용체 항체(E-9)는 인간 유래의 세크레틴 수용체 단백질을 WB, IP, IF 및 ELISA로 검출하는 IgG1 κ 마우스 단일 클론 세크레틴 수용체 항체(세크레틴 수용체 항체로도 지정됨)입니다. 세크레틴 수용체 항체(E-9)는 비접합 항-세크레틴 수용체 항체 형태뿐만 아니라 아가로스, HRP, PE, FITC 및 다중 Alexa Fluor® 접합체를 포함한 여러 접합 형태의 항-세크레틴 수용체 항체 형태로도 사용할 수 있습니다. 세크레틴은 근위 소장 점막에 위치한 특정 내분비 세포인 S 세포에서 생성되는 27개의 아미노산 호르몬입니다. 세크레틴은 중탄산염이 풍부한 췌액 분비를 강력하게 자극하는 것으로 알려져 있습니다. 세크레틴의 분비는 십이지장의 산성 pH 또는 지방산의 존재에 의해 자극됩니다. 세크레틴은 더 큰 전구체로 합성됩니다. 추론된 아미노산 서열에는 신호 펩타이드, 아미노 말단 펩타이드, 세크레틴 자체, 72-아미노산 카르복시 말단 펩타이드가 포함됩니다. 세크레틴은 담관세포와 직접 상호 작용하여 담관 담즙 분비를 자극합니다. 주로 수로 아쿠아포린-1을 통해 물을 운반하는 담관세포의 세포 외 배출을 자극합니다. 세크레틴 결핍은 자폐증후군과 관련이 있을 수 있으며, 이는 이 호르몬이 소화 역할 외에도 신경 내분비 기능을 가지고 있을 수 있음을 시사합니다. 세크레틴을 암호화하는 유전자는 인간 염색체 11p15.5에 매핑됩니다.

    연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

    Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

    LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

    secretin receptor 항체 (E-9) 참고문헌:

    1. 인간 세크레틴(SCT): 유전자 구조, 염색체 위치 및 mRNA의 분포.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. 췌장 분비의 메커니즘.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. 세크레틴: 전구체의 구조와 mRNA의 조직 분포.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. 돼지 세크레틴의 구조. 아미노산 서열.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. 세크레틴은 혈장막의 아쿠아포린-1 수로를 증가시켜 쥐 담관세포에서 삼투성 수분 수송을 촉진합니다. 세크레틴에 의한 아쿠아포린-1의 소포 전위에 대한 증거.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    주문정보

    제품명카탈로그 번호 단위가격수량관심품목

    secretin receptor 항체 (E-9)

    sc-166112
    200 µg/ml
    $316.00

    secretin receptor (E-9): m-IgG Fc BP-HRP 번들

    sc-527138
    200 µg Ab; 10 µg BP
    $354.00

    secretin receptor (E-9): m-IgG1 BP-HRP 번들

    sc-532511
    200 µg Ab; 20 µg BP
    $354.00

    secretin receptor 항체 (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $416.00

    secretin receptor 항체 (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $316.00

    secretin receptor 항체 (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $330.00

    secretin receptor 항체 (E-9) PE

    sc-166112 PE
    200 µg/ml
    $343.00

    secretin receptor 항체 (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $357.00

    secretin receptor 항체 (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $357.00

    secretin receptor 항체 (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $357.00

    secretin receptor 항체 (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $357.00

    secretin receptor 항체 (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $357.00

    secretin receptor 항체 (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $357.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Asked by: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Answered by: Jiajun Z
    Date published: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Asked by: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Answered by: Tech Support Europe
    Date published: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Asked by: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Answered by: Technical Service
    Date published: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Asked by: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Answered by: Technical Support
    Date published: 2017-02-27
    • y_2025, m_9, d_7, h_4CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_ko_KR, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 102ms
    • QUESTIONS, PRODUCT
    Rated 1 out of 5 by from Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Date published: 2021-04-09
    Rated 4 out of 5 by from Good antibodyWorks as we expected. Tested by immunofluorescence.
    Date published: 2018-12-18
    Rated 4 out of 5 by from This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Date published: 2018-01-19
    Rated 5 out of 5 by from Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Date published: 2014-05-08
    • y_2025, m_9, d_7, h_4
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_ko_KR, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 17ms
    • REVIEWS, PRODUCT
    secretin receptor 항체 (E-9) is rated 3.5 out of 5 by 4.
    • y_2025, m_9, d_7, h_4
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_ko_KR, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 104ms
    • REVIEWS, PRODUCT