Date published: 2026-9-3

1-800-457-3801

SCBT Portrait Logo
Seach Input

secretin Anticuerpo (E-9): sc-166112

3.5(4)
Escribir una reseñaHacer una pregunta

Fichas Técnicas
  • secretin Anticuerpo E-9 es un monoclonal de ratón IgG1 (kappa light chain) secretin Anticuerpo proporcionado como 200 µg/ml
  • planteada frente a los aminoácidos 33-121 mapeados dentro de un dominio extracelular N-terminal de secretin de human origen
  • secretin Anticuerpo (E-9) es recomendado para detectar secretin de human origen, mediante WB, IP, IF y ELISA
  • secretin Anticuerpo (E-9) es disponible conjugado a agarosa para IP; HRP para WB, IHC(P) y ELISA; y tanto a phycoerythrin como a FITC para IF, IHC(P) y FCM
  • también disponible conjugado a Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 o Alexa Fluor® 647 para WB (RGB), IF, IHC (P) y FCM
  • también disponible conjugado a Alexa Fluor® 680 o Alexa Fluor® 790 para WB (NIR), IF y FCM
  • m-IgG Fc BP-HRP y m-IgG1 BP-HRP son los reactivos de detección secundarios preferidos para secretin Anticuerpo (E-9) for WB applications. Estos reactivos se ofrecen ahora en paquetes con secretin Anticuerpo (E-9)(véase la información de pedido más abajo).
    Gene Editing Promo Banner

    ENLACES RÁPIDOS

    VER TAMBIÉN ....

    Para uso exclusivo en Investigación No está diseñado para para Diagnóstico ó Terapia.

    Alexa Fluor® es una marca registrada de Molecular Probes Inc., OR., USA

    REIVEW LI-COR® y Odyssey® son marcas registradas de LI-COR Biosciences.

    secretin Anticuerpo (E-9) Referencias:

    1. Secretina humana (SCT): estructura del gen, localización cromosómica y distribución del ARNm.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. Mecanismo de secreción pancreática.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Secretina: estructura del precursor y distribución tisular del ARNm.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Estructura de la secretina porcina. La secuencia de aminoácidos.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. La secretina promueve el transporte osmótico de agua en los colangiocitos de rata aumentando los canales de agua de la acuaporina-1 en la membrana plasmática. Evidence for a secretin-induced vesicular translocation of aquaporin-1.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Información sobre pedidos

    Nombre del productoNúmero de catálogoUNIDADPrecioCANTIDADFavoritos

    secretin Anticuerpo (E-9)

    sc-166112
    200 µg/ml
    $322.00

    Paquete de secretin (E-9): m-IgG Fc BP-HRP

    sc-527138
    200 µg Ab; 10 µg BP
    $361.00

    Paquete de secretin (E-9): m-IgG1 BP-HRP

    sc-532511
    200 µg Ab; 20 µg BP
    $361.00

    secretin Anticuerpo (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    $424.00

    secretin Anticuerpo (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    $322.00

    secretin Anticuerpo (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    $336.00

    secretin Anticuerpo (E-9) PE

    sc-166112 PE
    200 µg/ml
    $349.00

    secretin Anticuerpo (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    $364.00

    secretin Anticuerpo (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    $364.00

    secretin Anticuerpo (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    $364.00

    secretin Anticuerpo (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    $364.00

    secretin Anticuerpo (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    $364.00

    secretin Anticuerpo (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    $364.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Preguntado por: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Respondida por: Jiajun Z
    Fecha de publicación: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Preguntado por: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Respondida por: Tech Support Europe
    Fecha de publicación: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Preguntado por: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Respondida por: Technical Service
    Fecha de publicación: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Preguntado por: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Respondida por: Technical Support
    Fecha de publicación: 2017-02-27
    • y_2026, m_9, d_2, h_11CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_es_ES, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 128ms
    • QUESTIONS, PRODUCT
    Rated 1 de 5 por de Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Fecha de publicación: 2021-04-09
    Rated 4 de 5 por de Good antibodyWorks as we expected. Tested by immunofluorescence.
    Fecha de publicación: 2018-12-18
    Rated 4 de 5 por de This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Fecha de publicación: 2018-01-19
    Rated 5 de 5 por de Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Fecha de publicación: 2014-05-08
    • y_2026, m_9, d_2, h_11
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_es_ES, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 19ms
    • REVIEWS, PRODUCT
    secretin receptor Anticuerpo (E-9) clasificado 3.5 de 5 por 4.
    • y_2026, m_9, d_2, h_11
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.48
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_es_ES, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 151ms
    • REVIEWS, PRODUCT