Date published: 2026-4-23

1-800-457-3801

SCBT Portrait Logo
Seach Input

Anticorps VIP (H-6): sc-25347

4.9(11)
Écrire une critiquePoser une question

Fiches techniques
  • L'anticorps VIP H-6 est un monoclonal IgG2b κ L'Anticorps VIP, cité dans 38 publications, fourni en 200 µg/ml
  • dirigé contre les acides aminés 1-95 de vasoactive intestinal peptide (VIP) d'origine human
  • L'Anticorps VIP (H-6) est recommandé pour la détection de VIP d'origine human par WB, IP, IF, IHC(P) et ELISA
  • Anti-L'Anticorps VIP (H-6) est disponible conjugué à l'agarose pour IP; à l'HRP pour WB, IHC(P) et ELISA; et soit à la phycoerythrin ou FITC pour IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 ou Alexa Fluor® 647 pour WB (RGB), IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 680 ou Alexa Fluor® 790 pour WB (NIR), IF et FCM
  • 2b BP-HRP">m-IgG2b BP-HRP et m-IgGκ BP-HRP sont les réactifs de détection secondaire préférés pour l'anticorps VIP (H-6) pour les applications WB et IHC(P). Ces réactifs sont désormais proposés en lots avec l'anticorps VIP (H-6)(voir les informations relatives à la commande ci-dessous).
Gene Editing Promo Banner

ACCÈS RAPIDE AUX LIENS

VOIR ÉGALEMENT...

L'anticorps VIP (H-6) est un anticorps monoclonal de souris IgG2b à chaîne légère kappa conçu pour détecter le peptide intestinal vasoactif (VIP) humain, également connu sous le nom de PHM27 ou de membre de la famille du glucagon. L'anticorps monoclonal VIP (H-6) est dirigé contre les acides aminés 1 à 95 de la protéine VIP, ce qui garantit une liaison précise et une forte affinité dans diverses techniques expérimentales, notamment le western blotting (WB), l'immunoprécipitation (IP), l'immunofluorescence (IF), l'immunohistochimie sur coupes extraites de paraffine (IHCP) et l'essai immuno-enzymatique (ELISA). Le peptide intestinal vasoactif joue un rôle essentiel dans la relaxation et la vasodilatation des muscles lisses, régulant ainsi la pression artérielle et facilitant la sécrétion intestinale d'eau et d'électrolytes, ce qui souligne son importance dans la recherche cardiovasculaire et gastro-intestinale. Au-delà de ses effets vasodilatateurs, le VIP fait partie intégrante de la neuroprotection, de la modulation du système immunitaire et présente des propriétés anti-inflammatoires, ce qui fait de l'anticorps VIP (H-6) un outil clé dans divers processus physiologiques et applications thérapeutiques potentielles. L'anticorps monoclonal VIP (H-6) est disponible à la fois sous forme non conjuguée et sous plusieurs formes conjuguées, notamment la peroxydase de raifort (HRP), la phycoérythrine (PE), l'isothiocyanate de fluorescéine (FITC) et divers colorants Alexa Fluor®, ce qui permet de répondre à un large éventail de montages expérimentaux. L'anticorps anti-VIP (H-6) permet aux scientifiques d'étudier efficacement les mécanismes impliquant le VIP et d'identifier des cibles thérapeutiques potentielles pour les pathologies liées à la vasodilatation, à la régulation immunitaire et aux réponses inflammatoires.

Pour la Recherche Uniquement. Non destiné à un usage diagnostique ou thérapeutique.

Alexa Fluor® est une marque déposée de Molecular Probes Inc., OR., USA

LI-COR® et Odyssey® sont marques déposées de LI-COR Biosciences

Anticorps VIP (H-6) Références:

  1. Traitement différentiel du proglucagon par les prohormones convertases de type subtilisine PC2 et PC3 pour générer soit du glucagon, soit du peptide de type glucagon.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. Expression et activité fonctionnelle des récepteurs du glucagon, du glucagon-like peptide I et du peptide insulinotrope dépendant du glucose dans les cellules des îlots pancréatiques de rat.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. Intolérance au glucose mais satiété normale chez les souris présentant une mutation nulle du gène du récepteur du peptide 1 de type glucagon.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. Le peptide intestinal vasoactif (VIP) stimule la croissance in vitro des cellules dérivées de l'adénocarcinome pancréatique humain portant le récepteur VIP-1.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. Spécificités du métabolisme du glycogène dans le foie.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. Le polypeptide activateur de l'adénylate cyclase hypophysaire (PACAP) 38 et le PACAP27 activent des voies de signalisation intracellulaires communes et distinctes pour stimuler la sécrétion de l'hormone de croissance par les somatotropes porcins.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

Informations pour la commande

Nom du produitRef. CatalogueCOND.Prix HTQTÉFavoris

Anticorps VIP (H-6)

sc-25347
200 µg/ml
$322.00

VIP (H-6): m-IgGκ BP-HRP Kit

sc-520782
200 µg Ab, 40 µg BP
$361.00

VIP (H-6): m-IgG2b BP-HRP Kit

sc-548853
200 µg Ab; 10 µg BP
$361.00

Anticorps VIP (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
$424.00

Anticorps VIP (H-6) HRP

sc-25347 HRP
200 µg/ml
$322.00

Anticorps VIP (H-6) FITC

sc-25347 FITC
200 µg/ml
$336.00

Anticorps VIP (H-6) PE

sc-25347 PE
200 µg/ml
$349.00

Anticorps VIP (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
$364.00

Anticorps VIP (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
$364.00

Anticorps VIP (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
$364.00

Anticorps VIP (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
$364.00

Anticorps VIP (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
$364.00

Anticorps VIP (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
$364.00

Can you take a picture of the product‘s package? Can' t find it after cleaning the lab...

Posée par: Anonyme
Thank you for your question. Please contact our Technical Service Department. Our Asian Technical Service team is available at (+86) 021-60936350 or asia@scbio.cn or by live chat on our website.
Répondue par: Sen Li
Date de publication: 2026-01-30

Hi, does this antibody work with IHC on free floating sections from mouse?

Posée par: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email scbt@scbt.com.
Répondue par: BlakeJ
Date de publication: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Posée par: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Répondue par: Tech Support Europe
Date de publication: 2021-09-13

Did you test this antibody in flowcytometry ?

Posée par: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Répondue par: Tech Service
Date de publication: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Posée par: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Répondue par: Tech Service
Date de publication: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Posée par: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Répondue par: Technical Support
Date de publication: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Posée par: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Répondue par: SCBT Heidelberg Support
Date de publication: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Posée par: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Répondue par: Technical Support Europe
Date de publication: 2018-01-10
  • y_2026, m_4, d_22, h_10CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_9
  • loc_fr_FR, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 112ms
  • QUESTIONS, PRODUCT
Rated 5 de 5 de par Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Date de publication: 2024-11-07
Rated 5 de 5 de par Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Date de publication: 2023-02-02
Rated 5 de 5 de par It looked greatI ordered this a month ago and it worked great! I will purchase again
Date de publication: 2018-05-04
Rated 5 de 5 de par Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date de publication: 2018-01-31
Rated 5 de 5 de par GoodThe analysis results of WB were very stong and clear, it worked well for WB
Date de publication: 2017-06-08
Rated 5 de 5 de par Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date de publication: 2017-01-11
Rated 4 de 5 de par Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date de publication: 2015-07-08
Rated 5 de 5 de par Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date de publication: 2015-06-02
  • y_2026, m_4, d_22, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_fr_FR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
Anticorps VIP (H-6) est évalué 4.9 de 5 de 11.
  • y_2026, m_4, d_22, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_fr_FR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 113ms
  • REVIEWS, PRODUCT