Date published: 2025-12-12

00800 4573 8000

SCBT Portrait Logo
Seach Input

VIP Anticorpo (H-6): sc-25347

4.9(11)
Escrever uma avaliaçãoFazer uma pergunta

Fichas de dados
  • VIP Anticorpo H-6é um anticorpo monoclonal produzido em camundongo IgG2b κ VIP anticorpo, citado em 38 publicações, fornecido em 200 µg/ml
  • Produzido contra aminoácidos 1-95 de vasoactive intestinal peptide (VIP) de human origem
  • VIP Anticorpo (H-6) é recomendado para a detecção de VIP of human origin by WB, IP, IF, IHC(P) and ELISA
  • Anticorpo anti-VIP O anticorpo anti-VIP (H-6) está disponível conjugado com agarose para IP; HRP para WB, IHC(P) e ELISA; e com fioeritrina ou FITC para IF, IHC(P) e FCM
  • também disponível conjugado com Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 ou Alexa Fluor® 647 para WB (RGB), IF, IHC(P) e FCM, e para utilização com sistemas de imagiologia fluorescente RGB, tais como iBright™ FL1000, FluorChem™, Typhoon, Azure e outros sistemas comparáveis
  • também disponível conjugado com Alexa Fluor® 680 ou Alexa Fluor® 790 para WB (NIR), IF e FCM; para utilização com sistemas de deteção de infravermelhos próximos (NIR), tais como LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure e outros sistemas comparáveis
  • 2b BP-HRP">m-IgG2b BP-HRP e m-IgGκ BP-HRP são os reagentes de deteção secundários preferidos para VIP Antibody (H-6) para aplicações WB e IHC(P). Estes reagentes são agora oferecidos em conjuntos com VIP Antibody (H-6)(ver informações de encomenda abaixo).

LINKS RÁPIDOS

VEJA TAMBÉM

O anticorpo VIP (H-6) é um anticorpo monoclonal de cadeia leve IgG2b kappa de camundongo concebido para detetar o péptido intestinal vasoativo humano (VIP), também conhecido como PHM27 ou membro da família do glucagon. O anticorpo monoclonal VIP (H-6) foi criado contra os aminoácidos 1-95 da proteína VIP, assegurando uma ligação protéica precisa e uma elevada afinidade em várias técnicas experimentais, incluindo western blotting (WB), imunoprecipitação (IP), imunofluorescência (IF), imunohistoquímica com secções incluídas em parafina (IHCP) e ensaio de imunoabsorção enzimática (ELISA). O peptídeo intestinal vasoativo desempenha um papel fundamental no relaxamento e vasodilatação do músculo liso, regulando assim a pressão sanguínea e facilitando a secreção intestinal de água e electrólitos, o que sublinha a sua importância na investigação cardiovascular e gastrointestinal. Para além dos seus efeitos vasodilatadores, o VIP é parte integrante da neuroprotecção, da modulação do sistema imunitário e apresenta propriedades anti-inflamatórias, o que faz do anticorpo VIP (H-6) uma ferramenta fundamental em diversos processos fisiológicos e potenciais aplicações terapêuticas. O anticorpo monoclonal VIP (H-6) está disponível tanto em formas não conjugadas como em múltiplas formas conjugadas, incluindo peroxidase de rábano (HRP), ficoeritrina (PE), isotiocianato de fluoresceína (FITC) e vários corantes Alexa Fluor®, proporcionando flexibilidade para uma vasta gama de configurações experimentais. O anticorpo anti-VIP (H-6) permite aos cientistas estudar eficazmente os mecanismos que envolvem o VIP e identificar potenciais alvos terapêuticos para doenças relacionadas com a vasodilatação, a regulação imunitária e as respostas inflamatórias.

Para uso em exclusivo em pesquisa. Não se destina a uso em diagnostico e tratamento.

Alexa Fluor® é uma marca comercial da Molecular Probes Inc., OR., EUA

LI-COR® e Odyssey® são marcas registadas da LI-COR Biosciences

Referencias do VIP Anticorpo (H-6):

  1. Processamento diferencial do proglucagon pelas conversões de prohormonas do tipo subtilisina PC2 e PC3 para gerar glucagon ou péptido semelhante ao glucagon.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. Expressão e atividade funcional dos receptores do glucagon, do péptido semelhante ao glucagon I e do péptido insulinotrópico dependente da glicose nas células das ilhotas pancreáticas do rato.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. Intolerância à glicose mas saciedade normal em ratinhos com uma mutação nula no gene do recetor do péptido 1 semelhante ao glucagon.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. O péptido intestinal vasoativo (VIP) estimula o crescimento in vitro de células derivadas de adenocarcinoma pancreático humano portadoras do recetor VIP-1.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. Características específicas do metabolismo do glicogénio no fígado.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. O polipeptídeo ativador da adenilato ciclase hipofisária (PACAP) 38 e o PACAP27 activam vias de sinalização intracelular comuns e distintas para estimular a secreção da hormona do crescimento nos somatotropos porcinos.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

Informacoes sobre ordens

Nome do ProdutoNumero de CatalogoUNIDPrecoQdeFAVORITOS

VIP Anticorpo (H-6)

sc-25347
200 µg/ml
$316.00

Pacote do VIP (H-6): m-IgGκ BP-HRP

sc-520782
200 µg Ab, 40 µg BP
$354.00

Pacote do VIP (H-6): m-IgG2b BP-HRP

sc-548853
200 µg Ab; 10 µg BP
$354.00

VIP Anticorpo (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
$416.00

VIP Anticorpo (H-6) HRP

sc-25347 HRP
200 µg/ml
$316.00

VIP Anticorpo (H-6) FITC

sc-25347 FITC
200 µg/ml
$330.00

VIP Anticorpo (H-6) PE

sc-25347 PE
200 µg/ml
$343.00

VIP Anticorpo (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
$357.00

VIP Anticorpo (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
$357.00

VIP Anticorpo (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
$357.00

VIP Anticorpo (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
$357.00

VIP Anticorpo (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
$357.00

VIP Anticorpo (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
$357.00

Hi, does this antibody work with IHC on free floating sections from mouse?

Asked by: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email scbt@scbt.com.
Answered by: BlakeJ
Date published: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Asked by: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Answered by: Tech Support Europe
Date published: 2021-09-13

Did you test this antibody in flowcytometry ?

Asked by: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Answered by: Tech Service
Date published: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Asked by: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Answered by: Tech Service
Date published: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Asked by: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Answered by: Technical Support
Date published: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Asked by: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Answered by: SCBT Heidelberg Support
Date published: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Asked by: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Answered by: Technical Support Europe
Date published: 2018-01-10

Can VIP (H-6): sc-25347 monoclonal antibody be used for double or triple staining, if the other primary antibodies are also raised in mouse?

Asked by: cjMara
In this case, we recommend using a directly conjugated mouse monoclonal primary antibody. VIP (H-6): sc-25347 monoclonal antibody is currently available conjugated to PE, FITC, Alexa Fluor 488, and Alexa Fluor 647.
Answered by: Technical Support 15
Date published: 2017-01-22
  • y_2025, m_12, d_5, h_10CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_8
  • loc_pt_PT, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 131ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Date published: 2024-11-07
Rated 5 out of 5 by from Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Date published: 2023-02-02
Rated 5 out of 5 by from It looked greatI ordered this a month ago and it worked great! I will purchase again
Date published: 2018-05-04
Rated 5 out of 5 by from Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date published: 2018-01-31
Rated 5 out of 5 by from GoodThe analysis results of WB were very stong and clear, it worked well for WB
Date published: 2017-06-08
Rated 5 out of 5 by from Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date published: 2017-01-11
Rated 4 out of 5 by from Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date published: 2015-07-08
Rated 5 out of 5 by from Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date published: 2015-06-02
  • y_2025, m_12, d_5, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_pt_PT, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 18ms
  • REVIEWS, PRODUCT
VIP Anticorpo (H-6) is rated 4.9 out of 5 by 11.
  • y_2025, m_12, d_5, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_pt_PT, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 134ms
  • REVIEWS, PRODUCT