Date published: 2026-6-4

1-800-457-3801

SCBT Portrait Logo
Seach Input

Neuropeptide Y (CAS 90880-35-6)

0.0(0)
Write a reviewAsk a question

See product citations (5)

Alternate Names:
NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Application:
Neuropeptide Y is a potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
CAS Number:
90880-35-6
Purity:
>97% pure by HPLC
Molecular Weight:
4271.7
Molecular Formula:
C189H285N55O57S
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
* Refer to Certificate of Analysis for lot specific data.

QUICK LINKS

Neuropeptide Y (NPY) is a 36-amino acid peptide that is highly conserved across species and functions primarily as a neurotransmitter in the central nervous system. It is one of the most abundant neuropeptides in the brain and is involved in a variety of physiological processes including energy balance, memory, and learning. NPY operates by binding to a family of G-protein-coupled receptors, known as Y receptors, which include several subtypes: Y1, Y2, Y4, and Y5, each mediating different physiological functions. Research applications of NPY have been extensive, focusing on its role in the regulation of food intake, circadian rhythms, and stress responses. In experimental studies, NPY has been used to examine its potent stimulatory effects on food intake, making it a key molecule in the study of obesity and metabolism. Additionally, NPY is investigated for its involvement in modulating emotional-affective processes and its high levels in stress-resilient individuals, providing insights into stress management mechanisms. Researchers also use NPY to explore its neuroprotective properties and its impact on neurogenesis and synaptic plasticity, contributing significantly to the understanding of neuronal adaptation and resilience.


Neuropeptide Y (CAS 90880-35-6) References

  1. Neuropeptide Y receptors; antisecretory control of intestinal epithelial function.  |  Cox, HM. 2007. Auton Neurosci. 133: 76-85. PMID: 17140858
  2. Neuropeptide Y overexpression using recombinant adeno-associated viral vectors.  |  Noé, F., et al. 2009. Neurotherapeutics. 6: 300-6. PMID: 19332323
  3. Neuropeptide Y and peptide YY: important regulators of energy metabolism.  |  Nguyen, AD., et al. 2011. Curr Opin Endocrinol Diabetes Obes. 18: 56-60. PMID: 21157324
  4. The neuropeptide Y system: pathophysiological and therapeutic implications in obesity and cancer.  |  Zhang, L., et al. 2011. Pharmacol Ther. 131: 91-113. PMID: 21439311
  5. Neuropeptide Y and its Involvement in Chronic Pain.  |  Diaz-delCastillo, M., et al. 2018. Neuroscience. 387: 162-169. PMID: 28890052
  6. Physiological and Therapeutic Roles of Neuropeptide Y on Biological Functions.  |  Shende, P. and Desai, D. 2020. Adv Exp Med Biol. 1237: 37-47. PMID: 31468359
  7. Neuropeptide Y Antagonizes Development of Pulmonary Fibrosis through IL-1β Inhibition.  |  Itano, J., et al. 2022. Am J Respir Cell Mol Biol. 67: 654-665. PMID: 36122332
  8. Spinal neuropeptide Y Y1 receptor-expressing neurons are a pharmacotherapeutic target for the alleviation of neuropathic pain.  |  Nelson, TS., et al. 2022. Proc Natl Acad Sci U S A. 119: e2204515119. PMID: 36343228
  9. Neuropeptide Y regulates osteocyte phenotype and function through AHNAK-Smad signalling.  |  Wu, X., et al. 2023. J Mol Endocrinol. 71: PMID: 37163251
  10. Neuropeptide Y family of hormones: receptor subtypes and antagonists.  |  Balasubramaniam, AA. 1997. Peptides. 18: 445-57. PMID: 9145434

Ordering Information

Product NameCatalog #UNITPriceQtyFAVORITES

Neuropeptide Y, 0.5 mg

sc-3140
0.5 mg
$97.00