Date published: 2026-4-3

1-800-457-3801

SCBT Portrait Logo
Seach Input

CAP-18 항체 (G-1): sc-166055

5.0(3)
리뷰 쓰기질문하기

데이터 시트
  • CAP-18 항체 G-1 는 마우스 monoclonal IgG2a κ CAP-18 항체, 10간행물에 인용, 이며 200 µg/ml으로 제공합니다.
  • 아미노산에 대해 제기됨 6-175 CAP-18의 C-terminus에 매핑됨 rat 기원
  • CAP-18 항체 (G-1)는 WB, IP, IF and ELISA으로 mouse and rat유래의 CAP-18 를 감지하는 데에 추천한다.
  • 항-CAP-18 항체(G-1)는 IP용 agarose와 결합되어 이용 가능하며, WB, IHC(P), ELISA용 HRP와 결합되어 이용 가능하며, IF, IHC(P), FCM용 phycoerythrin 또는 FITC와 결합되어 이용 가능합니다.
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • m-IgG Fc BP-HRP, 2a BP-HRP">m-IgG2a BP-HRPm-IgGκ BP-HRP는 CAP-18 항체(G-1) WB 애플리케이션용입니다. 이 시약은 이제 CAP-18 항체(G-1)와 함께 번들로 제공됩니다(아래 주문 정보 참조).
Gene Editing Promo Banner

빠른 링크

더보기

CAP-18 항체(G-1)는 마우스 및 랫트 유래의 CAP-18을 웨스턴 블롯팅(WB), 면역침전(IP), 면역형광(IF), 효소결합면역흡착분석(ELISA)을 통해 검출하는 마우스 단일클론 IgG2a 카파 경쇄 항체입니다. CAP-18(G-1) 항체는 비접합 형태와 아가로스, 호스래디시 퍼옥시다아제(HRP), 피코에리트로핀(PE), 플루오레세인 이소티오시아네이트(FITC), 그리고 여러 알렉사 플루오르® 접합체를 포함한 다양한 접합체 형태로 제공됩니다. 카텔리시딘 항균 펩타이드라고도 알려진 CAP-18은 감염을 예방하고 염증을 조절하는 항균 작용을 통해 선천성 면역 반응에 중요한 역할을 합니다. CAP-18은 주로 호중구, 골수, 고환에서 발현되며, 특히 CAP-18이 높은 수준으로 발견되는 건선과 피부염과 같은 염증성 피부 질환에서 중요한 역할을 합니다. CAP-18은 양친매성 α-헬릭스 구조를 채택하는 능력으로 잘 알려진 항균성 펩타이드 LL-37을 포함하고 있으며, 이로 인해 CAP-18은 세균성 리포폴리사카라이드와 효과적으로 상호작용하고 감염 부위에 면역세포를 모집할 수 있습니다. 염증성 질환에서 LL-37의 존재는 숙주 방어 메커니즘에서 CAP-18의 중요성을 강조하며, 항-CAP-18 항체(G-1)를 항균성 펩타이드와 면역 반응에서의 역할을 연구하는 연구자들에게 필수적인 도구로 만들어 줍니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

CAP-18 항체 (G-1) 참고문헌:

  1. 인간 카텔리시딘인 hCAP-18은 프로테아제 3으로 세포 외 분해를 통해 항균 펩타이드 LL-37로 처리됩니다.  |  Sørensen, OE., et al. 2001. Blood. 97: 3951-9. PMID: 11389039
  2. 카텔리시딘 계열의 인간 항균 펩타이드 LL-37이 비만세포 화학 주성을 유도합니다.  |  Niyonsaba, F., et al. 2002. Immunology. 106: 20-6. PMID: 11972628
  3. 카텔리시딘 항균 펩타이드는 침샘과 타액에서 발현됩니다.  |  Murakami, M., et al. 2002. J Dent Res. 81: 845-50. PMID: 12454100
  4. 생쥐와 인간의 신생아 피부는 적응 반응이 발달하는 동안 선천성 면역인 항균 펩타이드의 수치가 증가합니다.  |  Dorschner, RA., et al. 2003. Pediatr Res. 53: 566-72. PMID: 12612195
  5. 쥐 카테리시딘 rCRAMP의 계통 발생, 처리 및 발현: 선천성 항균 펩타이드의 모델.  |  Termén, S., et al. 2003. Cell Mol Life Sci. 60: 536-49. PMID: 12737313
  6. 카테리시딘-구조, 기능 및 진화.  |  Tomasinsig, L. and Zanetti, M. 2005. Curr Protein Pept Sci. 6: 23-34. PMID: 15638766
  7. 항호중구 세포질 항체 관련 혈관염의 혈청학적 마커 및 잠재적 병원성 인자로서의 카텔리시딘 항균 펩타이드.  |  Gasim, A. 2014. Arthritis Res Ther. 16: 105. PMID: 25164257
  8. 카텔리시딘 항균 펩타이드는 간세포암종에서 종양 억제제로 작용합니다.  |  Huang, LH., et al. 2023. Int J Mol Sci. 24: PMID: 37958632
  9. 호중구와 뉴런에서 카텔리시딘 항균 펩타이드 발현은 신경 염증을 길항적으로 조절합니다.  |  Verma, SC., et al. 2024. J Clin Invest. 135: PMID: 39656548
  10. 골수에서 발현되는 새로운 쥐 카텔린 유사 단백질.  |  Popsueva, AE., et al. 1996. FEBS Lett. 391: 5-8. PMID: 8706928
  11. 배아 및 성체 마우스에서 발현되는 카틀린 관련 항균 펩타이드인 CRAMP를 확인했습니다.  |  Gallo, RL., et al. 1997. J Biol Chem. 272: 13088-93. PMID: 9148921
  12. 항균 펩타이드 LL-37을 코딩하는 유전자의 발현은 염증성 질환 동안 인간 각질 세포에서 유도됩니다.  |  Frohm, M., et al. 1997. J Biol Chem. 272: 15258-63. PMID: 9182550

주문정보

제품명카탈로그 번호 단위가격수량관심품목

CAP-18 항체 (G-1)

sc-166055
200 µg/ml
$322.00

CAP-18 (G-1): m-IgG Fc BP-HRP 번들

sc-528899
200 µg Ab; 10 µg BP
$361.00

CAP-18 (G-1): m-IgGκ BP-HRP 번들

sc-521497
200 µg Ab, 40 µg BP
$361.00

CAP-18 (G-1): m-IgG2a BP-HRP 번들

sc-547201
200 µg Ab; 10 µg BP
$361.00

CAP-18 항체 (G-1) AC

sc-166055 AC
500 µg/ml, 25% agarose
$424.00

CAP-18 항체 (G-1) HRP

sc-166055 HRP
200 µg/ml
$322.00

CAP-18 항체 (G-1) FITC

sc-166055 FITC
200 µg/ml
$336.00

CAP-18 항체 (G-1) PE

sc-166055 PE
200 µg/ml
$349.00

CAP-18 항체 (G-1) Alexa Fluor® 488

sc-166055 AF488
200 µg/ml
$364.00

CAP-18 항체 (G-1) Alexa Fluor® 546

sc-166055 AF546
200 µg/ml
$364.00

CAP-18 항체 (G-1) Alexa Fluor® 594

sc-166055 AF594
200 µg/ml
$364.00

CAP-18 항체 (G-1) Alexa Fluor® 647

sc-166055 AF647
200 µg/ml
$364.00

CAP-18 항체 (G-1) Alexa Fluor® 680

sc-166055 AF680
200 µg/ml
$364.00

CAP-18 항체 (G-1) Alexa Fluor® 790

sc-166055 AF790
200 µg/ml
$364.00

Is there an expected non specific band between 60-70 kDa? I have a very strong band in the area with faint or no bands near the 20-30 kDa range

Asked by: pciari
Thank you for your question. We do not expect a nonspecific band. Please contact our Technical Support department to troubleshoot the antibody. Please call (800)-457-3801 or email scbt@scbt.com
Answered by: BlakeJ
Date published: 2022-09-07

We intend to detect mCRAMP in mouse kidney tissue by western blot using this antibody. However, in the reference you suggested, CRAMP band is observed at 20KD for PMID#33468624 and #30094093, and at 28kDa for #32682918. What band is desirable to read when

Asked by: hongsang38
Thank you for your question. It would be helpful if you could call us, allowing for a more interactive discussion of this and other related questions.
Answered by: Technical Support
Date published: 2021-07-22

Hello. I would like to ask whether the CRAMP Antibody (G-1): sc-166055 recognizes C-terminal antimicrobial peptide released from precursor protein (ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE). Thank you! Piotr

Asked by: pkol
Thank you for your question. CRAMP Antibody (G-1): sc-166055 has been raised against amino acids 6-175 mapping at the C-terminus of CRAMP of rat origin. Since this amino acid range corresponds to a longer sequence than the one you have provided, it is possible that the antibody will not bind your sequence. This is a monoclonal antibody, so it only has one distinct epitope within its epitope region. Since no epitope mapping has been performed as of yet, we cannot say whether or not the antibody would recognize the sequence you reference.
Answered by: Tech Support Europe
Date published: 2020-08-28

Can CRAMP (G-1): sc-166055 monoclonal antibody be used in IF or IHC with mouse tissue or cells? Will there be non-specific staining?

Asked by: DefinitelyNotMatt
Thank you for your inquiry. The use of mouse monoclonal antibodies with mouse samples is very common and typically poses no problem. To eliminate any potential cross-reactivity of an anti-mouse secondary detection reagent, CRAMP (G-1): sc-166055 is available in a variety of direct conjugations, such as HRP, PE, FITC and AlexaFluors.
Answered by: Technical Support
Date published: 2017-02-24
  • y_2026, m_3, d_26, h_7CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_4
  • loc_ko_KR, sid_166055, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 107ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from very clearWonderful results with CRAMP Antibody (G-1) monoclonal antibody, this is good
Date published: 2017-05-19
Rated 5 out of 5 by from strong positive bandStrong positive band observed with CRAMP Antibody (G-1) with little to no background
Date published: 2017-01-31
Rated 5 out of 5 by from Produced nice Western blot data of CRAMPProduced nice Western blot data of CRAMP expression in CSMLO whole cell lysate. -SCBT QC
Date published: 2014-09-10
  • y_2026, m_3, d_26, h_7
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_ko_KR, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
CAP-18 항체 (G-1) is rated 5.0 out of 5 by 3.
  • y_2026, m_3, d_26, h_7
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_ko_KR, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 99ms
  • REVIEWS, PRODUCT