Iberiotoxin

Iberiotoxin (CAS 129203-60-7)

Iberiotoxin | CAS 129203-60-7 is rated 5.0 out of 5 by 1.
  • y_2019, m_2, d_21, h_16
  • bvseo_bulk, prod_bvrr, vn_bulk_2.0.11
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_3585, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 73ms
  • REVIEWS, PRODUCT
Synonym: IbTX; IBERIOTOXIN SCORPION BUTHUS TAMULUS
Application: A highly selective and potent high conductance Ca2+-activated K+ channel blocker
CAS Number: 129203-60-7
Purity: ≥98%
Molecular Weight: 4230.85
Molecular Formula: C179H274N50O55S7
Supplemental Information: This is classified as a Dangerous Good for transport and may be subject to additional shipping charges.
* Refer to Certificate of Analysis for lot specific data (including water content).
Submit a review for this product and receive 15 CruzCredits

Iberotoxin is a highly selective and potent blocker of the MaxiK (high conductance Ca2+ activated K+ channels) that does not affect other types of voltage-dependent K+ channels. Because of iberiotoxin's strong ability to block Ca2+ activated K+ channels, in mammalian motor nerve terminals the compound can induce dihydropyridine sensitive release of ACh. In rat organotypic dorsal striatal slices iberiotoxin and margatoxin (sc-3586) were both observed to induce production of c-fos like mRNA and protein. Iberiotoxin is an inhibitor of MaxiKα.


References

1. Galvez, A., et al. 1990. J. Biol. Chem. 265: 11083-11090. PMID: 1694175
2. Candia, S., et al. 1992. Biophys. J. 63: 583-590. PMID: 1384740
3. Saria, A., et al. 2000. Amino Acids. 19: 23-31. PMID: 11026470
4. Flink, M.T., et al. 2003. J. Pharmacol. Exp. Ther. 305: 646-652. PMID: 12606686
5. Roger, S., et al. 2004. Biochim. Biophys. Acta. 1667: 190-199. PMID: 15581855
6. Weaver, A.K., et al. 2004. J. Neurosci. Res. 78: 224-234. PMID: 15378515

Physical State :
Solid
Sequence :
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKC RCYQ
Solubility :
Soluble in water (1 mg/ml), NaCl (100 mM), Tris-HCl (10 mM), and pH 7.5 containing 0.1% BSA.
Storage :
Store at -20° C
IC50 :
high conductance Ca2+-activated K+ channels: IC50 = 250 pM
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
WGK Germany :
3
RTECS :
NH6107500
Transport :
UN 3462, Class 6.1, Packing group II
PubChem CID :
16132435
MDL Number :
MFCD00131365
SMILES :
CC(C)CC1C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CC(=O)O)CCCCN)NC(=O)C(C(C)C)NC(=O)C(CO)NC(=O)C(CC2=CNC3=CC=CC=C32)NC(=O)C4CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N4)CCC(=O)O)CCCCN)CO)C(C)C)CO)NC(=O)C(CC(=O)O)NC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C(C(C)O)NC(=O)C(CC5=CC=CC=C5)NC(=O)C6CCC(=O)N6)C(=O)NC(CCSC)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC7CSSCC(NC(=O)C(NC7=O)CCCNC(=N)N)C(=O)NC(CC8=CC=C(C=C8)O)C(=O)NC(CCC(=O)N)C(=O)O)CCCCN)CCCNC(=N)N)CC(=O)O)C(C)C)CC9=CC=CC=C9

Download SDS (MSDS)

Certificate of Analysis

Adobe Acrobat Reader is required to reliably view,
print and comment on PDF documents

Iberiotoxin  Product Citations

See how others have used Iberiotoxin. Click on the entry to view the PubMed entry .

Citations 1 to 10 of 13 total

PMID: # 27826078  Landa-Juárez, AY. et al. 2016. Eur. J. Pharmacol. 793: 95-100.

PMID: # 21719217  Choudhury, S. et al. 2011. Animal reproduction science. 126: 173-8.

PMID: # 18390821  Bratz, IN. et al. 2008. Am. J. Physiol. Heart Circ. Physiol. 294: H2489-H2496.

PMID: # 18656631  Liu, Y. et al. 2008. Surgery. 144: 239-244.

PMID: # 18227289  Redel, A. et al. 2008. Anesth Analg. 106: 384-391.

PMID: # 17382781  Lang, RJ. et al. 2007. J. Urol. 177: 1573-1580.

PMID: # 17409234  Jones, GJ. et al. 2007. J. Neurosci. 27: 3703-3711.

PMID: # 16891388  Leroy, C. et al. 2006. Am. J. Physiol. Lung Cell Mol. Physiol. 291: L1207-L1219.

PMID: # 15378515  Weaver, AK. et al. 2004. J. Neurosci. Res. 78: 224-234.

PMID: # 14634032  Lee, JH. et al. 2004. J. Pharmacol. Exp. Ther. 308: 896-903.

Citations 1 to 10 of 13 total
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 65ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Rated 5 out of 5 by from Iberiotoxin Iberiotoxin, a selective BK channel inhibitor, was used to see if this inhibition has an effect on tumor growth - specifically in human malignant glioma cells (PubMed ID 15378515). -SCBT Publication Review
Date published: 2015-05-20
  • y_2019, m_2, d_21, h_16
  • bvseo_bulk, prod_bvrr, vn_bulk_2.0.11
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_3585, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 226ms
  • REVIEWS, PRODUCT

Santa Cruz Biotechnology, Inc. is a world leader in the development of products for the biomedical research market. Call us Toll Free at 1-800-457-3801.
Copyright © 2007-2019 Santa Cruz Biotechnology, Inc. All Rights Reserved. "Santa Cruz Biotechnology", and the Santa Cruz Biotechnology, Inc. logo, "Santa Cruz Animal Health", "San Juan Ranch", "Supplement of Champions", the San Juan Ranch logo, "Ultracruz", "Chemcruz", "Immunocruz", "Exactacruz", and "EZ Touch" are registered trademarks of Santa Cruz Biotechnology, Inc.
All trademarks are the property of their respective owners.