Neuropeptide Y CAS: 90880-35-6
MF: C189H285N55O57S
MW: 4271.7
A potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels.

Neuropeptide Y (CAS 90880-35-6)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 116ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Nomes alternativos: NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Aplicação Neuropeptide Y is a potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
Numero VAT: 90880-35-6
Privada: >97% pure by HPLC
Peso Molecular: 4271.7
Separar por Funcao: C189H285N55O57S
Para uso em exclusivo em pesquisa. Não se destina a uso em diagnostico e tratamento.
* Refere-se a Certificado de Análise para data especifica de lotes (incluindo-se o conteúdo de agua).
loading

Neuropeptide Y is a biologically active peptide. A synthetic potassium channel blocker. A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells. Reactive with various species, including cow and pig.

Paginas :
Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Estado físico :
Solid
Sequencia :
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Manutencao :
Store at -20° C
Para uso em exclusivo em pesquisa. Não se destina a uso em diagnostico e tratamento.

Baixar SDS (MSDS)

Certificado de Análise

É necessário o Adobe Acrobat Reader para visualizar corretamente,
imprimir e comentar os documentos PDF

Neuropeptide Y (CAS 90880-35-6)  Citacoes dos Produtos

Visualizar com outras pessoas usaram Neuropeptide Y (CAS 90880-35-6). Clique em PubMed para ver .

Citações 1 para 4 de 4 total

PMID: # 27069867  2016. Molecular metabolism. 5: 271-82.

PMID: # 22249165  2012. EMBO reports. 13: 258-65.

PMID: # 21914774  2011. Endocrinology. 152: 4138-47.

PMID: # 17785501  2007. American journal of physiology. Endocrinology and metabolism. 293: E1335-40.

Citações 1 para 4 de 4 total
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 153ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 9ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;