Glucagon-Like Peptide 1 (7-36) Amide CAS: 107444-51-9
MF: C149H226N40O45
MW: 3297.67
A potent insulinotropic peptide.

Glucagon-Like Peptide 1 (7-36) Amide (CAS 107444-51-9)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 131ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Nomes alternativos: GLP-1; GLP-1 (7-36) amide; Insulinotropin
Aplicação Glucagon-Like Peptide 1 (7-36) Amide is a potent insulinotropic peptide
Numero VAT: 107444-51-9
Peso Molecular: 3297.67
Separar por Funcao: C149H226N40O45
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
* Refer to Certificate of Analysis for lot specific data (including water content).
loading

Glucagon-Like Peptide 1 (7-36) Amide is a potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Estado físico :
Solid
Sequencia :
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
envie :
Soluble in water (1 mg/ml).
Manutencao :
Desiccate at -20° C
Densidade :
~1.5 g/cm3 (Predicted)
Indice de produtos :
n20D 1.66 (Predicted)
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
RTECS :
LZ3980060
PubChem CID :
SMILES :
CC[[email protected]](C)[[email protected]@H](C(=O)N[[email protected]@H](C)C(=O)N[[email protected]@H](CC1=CNC2=CC=CC=C21)C(=O)N[[email protected]@H](CC(C)C)C(=O)N[[email protected]@H](C(C)C)C(=O)N[[email protected]@H](CCCCN)C(=O)NCC(=O)N[[email protected]@H](CCCNC(=N)N)C(=O)N)NC(=O)[[email protected]](CC3=CC=CC=C3)NC(=O)[[email protected]](CCC(=O)O)NC(=O)[[email protected]](CCCCN)NC(=O)[[email protected]](C)NC(=O)[[email protected]](C)NC(=O)[[email protected]](CCC(=O)N)NC(=O)CNC(=O)[[email protected]](CCC(=O)O)NC(=O)[[email protected]](CC(C)C)NC(=O)[[email protected]](CC4=CC=C(C=C4)O)NC(=O)[[email protected]](CO)NC(=O)[[email protected]](CO)NC(=O)[[email protected]](C(C)C)NC(=O)[[email protected]](CC(=O)O)NC(=O)[[email protected]](CO)NC(=O)[[email protected]]([[email protected]@H](C)O)NC(=O)[[email protected]](CC5=CC=CC=C5)NC(=O)[[email protected]]([[email protected]@H](C)O)NC(=O)CNC(=O)[[email protected]](CCC(=O)O)NC(=O)[[email protected]](C)NC(=O)[[email protected]](CC6=CNC=N6)N

Baixar SDS (MSDS)

Certificado de Análise

É necessário o Adobe Acrobat Reader para visualizar corretamente,
imprimir e comentar os documentos PDF

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 118ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 10ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;