Anti-VIP Antibody (H-6) recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA

Anti-VIP Antibody (H-6): sc-25347

Anti-VIP Antibody (H-6) is rated 4.9 out of 5 by 9.
  • y_2021, m_7, d_25, h_19
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.18
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_9
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 102ms
  • REVIEWS, PRODUCT
loading
5
8
4
1
3
0
2
0
1
0

Datasheets

    • Anti-VIP Antibody (H-6) is a mouse monoclonal IgG2b κ VIP antibody, cited in 32 publications, provided at 200 µg/ml
    • raised against amino acids 1-95 of VIP of human origin
    • VIP Antibody (H-6) is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA
    • Anti-VIP Antibody (H-6) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
    • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
    • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
    • Contact our Technical Service Department (or your local Distributor) for more information on how to receive a FREE 10 µg sample of VIP (H-6): sc-25347.
    • m-IgG2b BP-HRP and m-IgGκ BP-HRP are the preferred secondary detection reagents for VIP Antibody (H-6) for WB and IHC(P) applications. These reagents are now offered in bundles with VIP Antibody (H-6) (see ordering information below).
loading

Did you test this antibody in flowcytometry ?

Asked by: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Answered by: Tech Service
Date published: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Asked by: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Answered by: Tech Service
Date published: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Asked by: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Answered by: Technical Support
Date published: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Asked by: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Answered by: SCBT Heidelberg Support
Date published: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Asked by: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Answered by: Technical Support Europe
Date published: 2018-01-10

Can VIP (H-6): sc-25347 monoclonal antibody be used for double or triple staining, if the other primary antibodies are also raised in mouse?

Asked by: cjMara
In this case, we recommend using a directly conjugated mouse monoclonal primary antibody. VIP (H-6): sc-25347 monoclonal antibody is currently available conjugated to PE, FITC, Alexa Fluor 488, and Alexa Fluor 647.
Answered by: Technical Support 15
Date published: 2017-01-22
  • y_2021, m_7, d_25, h_19CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.18
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_6
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 119ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from It looked great I ordered this a month ago and it worked great! I will purchase again
Date published: 2018-05-04
Rated 5 out of 5 by from Very Good Great for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date published: 2018-01-31
Rated 5 out of 5 by from Good The analysis results of WB were very stong and clear, it worked well for WB
Date published: 2017-06-08
Rated 5 out of 5 by from Feel like a VIP VIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date published: 2017-01-11
Rated 4 out of 5 by from Positive results in western blot analysis Positive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date published: 2015-07-08
Rated 5 out of 5 by from Worked for western blot using crude extracts Worked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date published: 2015-06-02
Rated 5 out of 5 by from Used for western blotting with avian embryonic Used for western blotting with avian embryonic fibroblasts. -SCBT Publication Review
Date published: 2015-04-25
Rated 5 out of 5 by from Beautiful immunoperoxidase extracellular Beautiful immunoperoxidase extracellular staining in formalin-fixed, paraffin-embedded human colon tissue. -SCBT QC
Date published: 2015-03-03
  • y_2021, m_7, d_25, h_19
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.18
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_9
  • loc_en_US, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT