Neuropeptide Y CAS: 90880-35-6
MF: C189H285N55O57S
MW: 4271.7
A potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels.

Neuropeptide Y (CAS 90880-35-6)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 97ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Alternate Names: NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Application: Neuropeptide Y is a potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
CAS Number: 90880-35-6
Purity: >97% pure by HPLC
Molecular Weight: 4271.7
Molecular Formula: C189H285N55O57S
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
* Refer to Certificate of Analysis for lot specific data (including water content).
loading

Neuropeptide Y is a biologically active peptide. A synthetic potassium channel blocker. A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells. Reactive with various species, including cow and pig.

Usage :
Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Physical State :
Solid
Sequence :
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Storage :
Store at -20° C
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

Download SDS (MSDS)

Certificate of Analysis

Adobe Acrobat Reader is required to reliably view,
print and comment on PDF documents

Neuropeptide Y (CAS 90880-35-6)  Product Citations

See how others have used Neuropeptide Y (CAS 90880-35-6). Click on the entry to view the PubMed entry .

Citations 1 to 4 of 4 total

PMID: # 27069867  2016. Molecular metabolism. 5: 271-82.

PMID: # 22249165  2012. EMBO reports. 13: 258-65.

PMID: # 21914774  2011. Endocrinology. 152: 4138-47.

PMID: # 17785501  2007. American journal of physiology. Endocrinology and metabolism. 293: E1335-40.

Citations 1 to 4 of 4 total
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 94ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 8ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;