Iberiotoxin CAS: 129203-60-7
MF: C179H274N50O55S7
MW: 4230.85
A highly selective and potent high conductance Ca2+-activated K+ channel blocker.

Iberiotoxin (CAS 129203-60-7)

Iberiotoxin | CAS 129203-60-7 is rated 5.0 out of 5 by 1.
  • y_2021, m_6, d_21, h_18
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.17
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_3585, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 127ms
  • REVIEWS, PRODUCT
loading
5
1
4
0
3
0
2
0
1
0
Alternate Names: IbTX; IBERIOTOXIN SCORPION BUTHUS TAMULUS
Application: Iberiotoxin is a highly selective and potent high conductance Ca2+-activated K+ channel blocker
CAS Number: 129203-60-7
Purity: ≥98%
Molecular Weight: 4230.85
Molecular Formula: C179H274N50O55S7
Supplemental Information: This is classified as a Dangerous Good for transport and may be subject to additional shipping charges.
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
* Refer to Certificate of Analysis for lot specific data (including water content).
loading

Iberotoxin is a highly selective and potent blocker of the MaxiK (high conductance Ca2+ activated K+ channels) that does not affect other types of voltage-dependent K+ channels. Because of iberiotoxin's strong ability to block Ca2+ activated K+ channels, in mammalian motor nerve terminals the compound can induce dihydropyridine sensitive release of ACh. In rat organotypic dorsal striatal slices iberiotoxin and margatoxin (sc-3586) were both observed to induce production of c-fos like mRNA and protein. Iberiotoxin is an inhibitor of MaxiKα.


References

1. Galvez, A., et al. 1990. J. Biol. Chem. 265: 11083-11090. PMID: 1694175
2. Candia, S., et al. 1992. Biophys. J. 63: 583-590. PMID: 1384740
3. Saria, A., et al. 2000. Amino Acids. 19: 23-31. PMID: 11026470
4. Flink, M.T., et al. 2003. J. Pharmacol. Exp. Ther. 305: 646-652. PMID: 12606686
5. Roger, S., et al. 2004. Biochim. Biophys. Acta. 1667: 190-199. PMID: 15581855
6. Weaver, A.K., et al. 2004. J. Neurosci. Res. 78: 224-234. PMID: 15378515

Physical State :
Solid
Sequence :
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKC RCYQ
Solubility :
Soluble in water (1 mg/ml), NaCl (100 mM), Tris-HCl (10 mM), and pH 7.5 containing 0.1% BSA.
Storage :
Store at -20° C
IC50 :
high conductance Ca2+-activated K+ channels: IC50 = 250 pM
For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.
WGK Germany :
3
RTECS :
NH6107500
PubChem CID :
MDL Number :
MFCD00131365
SMILES :
CC(C)CC1C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)N1)CC(=O)O)CCCCN)NC(=O)C(C(C)C)NC(=O)C(CO)NC(=O)C(CC2=CNC3=CC=CC=C32)NC(=O)C4CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N4)CCC(=O)O)CCCCN)CO)C(C)C)CO)NC(=O)C(CC(=O)O)NC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C(C(C)O)NC(=O)C(CC5=CC=CC=C5)NC(=O)C6CCC(=O)N6)C(=O)NC(CCSC)C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC7CSSCC(NC(=O)C(NC7=O)CCCNC(=N)N)C(=O)NC(CC8=CC=C(C=C8)O)C(=O)NC(CCC(=O)N)C(=O)O)CCCCN)CCCNC(=N)N)CC(=O)O)C(C)C)CC9=CC=CC=C9

Download SDS (MSDS)

Certificate of Analysis

Adobe Acrobat Reader is required to reliably view,
print and comment on PDF documents

Iberiotoxin (CAS 129203-60-7)  Product Citations

See how others have used Iberiotoxin (CAS 129203-60-7). Click on the entry to view the PubMed entry .

Citations 1 to 10 of 15 total

PMID: # 27826078  Landa-Juárez, AY. et al. 2016. Eur. J. Pharmacol. 793: 95-100.

PMID: # 21719217  Choudhury, S. et al. 2011. Animal reproduction science. 126: 173-8.

PMID: # 18227289  Redel, A. et al. 2008. Anesth Analg. 106: 384-391.

PMID: # 18390821  Bratz, IN. et al. 2008. Am. J. Physiol. Heart Circ. Physiol. 294: H2489-H2496.

PMID: # 18656631  Liu, Y. et al. 2008. Surgery. 144: 239-244.

PMID: # 17382781  Lang, RJ. et al. 2007. J. Urol. 177: 1573-1580.

PMID: # 17409234  Jones, GJ. et al. 2007. J. Neurosci. 27: 3703-3711.

PMID: # 16891388  Leroy, C. et al. 2006. Am. J. Physiol. Lung Cell Mol. Physiol. 291: L1207-L1219.

PMID: # 15217912  Archer, SL. et al. 2004. Circ. Res. 95: 308-318.

PMID: # 15378515  Weaver, AK. et al. 2004. J. Neurosci. Res. 78: 224-234.

Citations 1 to 10 of 15 total
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 106ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Rated 5 out of 5 by from Iberiotoxin Iberiotoxin, a selective BK channel inhibitor, was used to see if this inhibition has an effect on tumor growth - specifically in human malignant glioma cells (PubMed ID 15378515). -SCBT Publication Review
Date published: 2015-05-20
  • y_2021, m_6, d_21, h_18
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.17
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_1
  • loc_en_US, sid_3585, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 14ms
  • REVIEWS, PRODUCT