Glucagon Antibody (C-11) recommended for detection of Proglucagon, Glucagon, GLP-1 and GLP-2 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA

Glucagon Antibody (C-11): sc-514592

Glucagon Antibody (C-11) is rated 5.0 out of 5 by 7.
  • y_2020, m_2, d_21, h_13
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.5
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_7
  • loc_en_US, sid_514592, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 132ms


    • Glucagon Antibody (C-11) is a mouse monoclonal IgG1 (kappa light chain) provided at 200 µg/ml
    • raised against amino acids 1-180 representing full length Glucagon of human origin
    • Glucagon Antibody (C-11) is recommended for detection of Proglucagon, Glucagon, GLP-1 and GLP-2 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA
    • Glucagon Antibody (C-11) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
    • also available conjugated to Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647 for WB (RGB), IF, IHC(P) and FCM, and for use with RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
    • also available conjugated to Alexa Fluor® 680 or Alexa Fluor® 790 for WB (NIR), IF and FCM; for use with Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems
    • See m-IgGκ BP-HRP (mouse IgGκ binding protein-HRP), our highly recommended recombinant alternative to conventional secondary anti-mouse IgG reagents.
    • Contact our Technical Service Department (or your local Distributor) for more information on how to receive a FREE 10 µg sample of Glucagon (C-11): sc-514592.
Submit a review for this product and receive 15 CruzCredits

Glucagon Antibody (C-11) HRP, sc-514592 HRP 200 µg/ml: Would this antibody reacts with liraglutide (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) in western-blotting.

Asked by: Pavan
Thank you for your question. Glucagon Antibody (C-11) HRP is a mouse monoclonal IgG raised against amino acids 1-180 of Glucagon of human origin. The exact epitope recognized by this antibody has not been determined, so although this aligns 100% with the liraglutide sequence you provided above, since we do not know exactly where the epitope is within 1-180, we can not guarantee that it can pick up the peptide in a WB experiment. If you have any further questions, please contact our Asia Technical Service team. You can reach them by phone at (86 21) 6093-6350, by email at: [email protected] or by live chat directly on our website,
Answered by: Tech Service
Date published: 2017-03-17

Can Glucagon (C-11): sc-514592 monoclonal antibody be used in IF or IHC with mouse tissue or cells? Will there be non-specific staining?

Asked by: TinTin
Thank you for your inquiry. The use of mouse monoclonal antibodies with mouse samples is very common and typically poses no problem. To eliminate any potential cross-reactivity of an anti-mouse secondary detection reagent, Glucagon (C-11): sc-514592 is available in a variety of direct conjugations, such as HRP, PE, FITC and AlexaFluors.
Answered by: Technical Support
Date published: 2017-02-24

Hi there. I am wondering whether you can tell me the specific IgG isotype of this antibody: Glucagon Antibody (C-11): sc-514592. Thank you!

Asked by: Juliaia
Thank you for your question. This antibody, sc-514592: Glucagon (C-11) is a mouse monoclonal IgG1 (kappa light chain).
Answered by: Technical Support
Date published: 2016-11-15
  • y_2020, m_2, d_21, h_13CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.5
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_3
  • loc_en_US, sid_514592, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 137ms
Rated 5 out of 5 by from Great antibody for IF Strong and clear signal on mouse pancreatic FFPE sections at 1/300 incubated ON 4°C and detected by Alexa 594.
Date published: 2018-01-05
Rated 5 out of 5 by from excellent antibody for immunofluorescent staining Test it on mouse pancreatic tissue cryosections (1:100) and counterstain with DAPI.
Date published: 2017-12-07
Rated 5 out of 5 by from worked well I brought this one month ago,it WORK well WITH IF.
Date published: 2017-10-23
Rated 5 out of 5 by from Excellent Antibody With concentration about 0.5ug/ml, weget perfect result!
Date published: 2017-07-25
Rated 5 out of 5 by from Worked well on FFPE mouse tissue Tested antibody on FFPE paraffin sections of mouse pancreas with following conditions: HIER 20min @ 100C pH6 Blocked with Biocare Rodent Block M - 20min RT Incubated ON @ 4C with sc-514592 @ 1:100 Detected with Alexa 647 and counterstained with DAPI
Date published: 2017-03-13
Rated 5 out of 5 by from Good with FFPE This antibody provides strong staining in IHC with paraffin-embedded sections when treated with citrate buffer and heat for antigen retrieval.
Date published: 2017-02-07
Rated 5 out of 5 by from need to use in our lab need to use in our lab
Date published: 2015-06-02
  • y_2020, m_2, d_21, h_13
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.5
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_7
  • loc_en_US, sid_514592, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 19ms

Santa Cruz Biotechnology, Inc. is a world leader in the development of products for the biomedical research market. Call us Toll Free at 1-800-457-3801.
Copyright © 2007-2020 Santa Cruz Biotechnology, Inc. All Rights Reserved. "Santa Cruz Biotechnology", and the Santa Cruz Biotechnology, Inc. logo, "Santa Cruz Animal Health", "San Juan Ranch", "Supplement of Champions", the San Juan Ranch logo, "Ultracruz", "Chemcruz", "Immunocruz", "Exactacruz", and "EZ Touch" are registered trademarks of Santa Cruz Biotechnology, Inc.
All trademarks are the property of their respective owners.