Neuropeptide Y CAS: 90880-35-6
MF: C189H285N55O57S
MW: 4271.7
A potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels.

Neuropeptide Y (CAS 90880-35-6)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 124ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Alternate Names: NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Application Neuropeptide Y is a potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
CAS 등록번호: 90880-35-6
순도: >97% pure by HPLC
분자량: 4271.7
분자식: C189H285N55O57S
연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.
* 참조분석증명서대량의 측정 데이터(함수량포함).
loading

Neuropeptide Y is a biologically active peptide. A synthetic potassium channel blocker. A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells. Reactive with various species, including cow and pig.

사용법 :
Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Physical State :
Solid
시퀀스 :
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
저장 :
Store at -20° C
연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

SDS(MSDS)다운로드

분석증명서

PDF문서를 열람,
프린트와 코멘트를 작성하려면 Adobe Acrobat Reader가 필요합니다.

Neuropeptide Y (CAS 90880-35-6)  논문정보

다른 사용자의 Neuropeptide Y (CAS 90880-35-6)사용법보기. 클릭하여 PubMed entry보기 .

인용 1 to 4 of 4 합계

PMID: # 27069867  2016. Molecular metabolism. 5: 271-82.

PMID: # 22249165  2012. EMBO reports. 13: 258-65.

PMID: # 21914774  2011. Endocrinology. 152: 4138-47.

PMID: # 17785501  2007. American journal of physiology. Endocrinology and metabolism. 293: E1335-40.

인용 1 to 4 of 4 합계
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 143ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 9ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;