Neuropeptide Y CAS: 90880-35-6
MF: C189H285N55O57S
MW: 4271.7
A potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels.

Neuropeptide Y (CAS 90880-35-6)

  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getAggregateRating, 112ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
Nomi alternativi: NPY, Human; YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Applicazione: Neuropeptide Y is a potassium channel blocker, potent vasoconstrictor and reversible inhibitor of Ca2+-activated K+ channels
Numero CAS: 90880-35-6
Purezza: >97% pure by HPLC
Peso molecolare: 4271.7
Formula molecolare: C189H285N55O57S
Solo per uso in Ricerca. Non previsto per Uso Diagnostico o Terapeutico.
* Vedere Certificato di Analisi per informazioni sul lotto specifico (incluso il contenuto d'acqua).
loading

Neuropeptide Y is a biologically active peptide. A synthetic potassium channel blocker. A potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells. Reactive with various species, including cow and pig.

Utilizzo :
Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Stato fisico :
Solid
Sequenza :
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
CONSERVAZIONE :
Store at -20° C
Solo per uso in Ricerca. Non previsto per Uso Diagnostico o Terapeutico.

Download SDS (MSDS)

CERTIFICATO DI ANALISI

Adobe Acrobat Reader necessario per una visualizzazione affidabile,
stampa e commenta sui documenti PDF

Neuropeptide Y (CAS 90880-35-6)  Citazioni prodotti

Vedi quanti altri hanno usato Neuropeptide Y (CAS 90880-35-6). Clicca sulla voce per laccesso a PubMed .

Ciatazioni 1 a4 di 4 totali

PMID: # 27069867  2016. Molecular metabolism. 5: 271-82.

PMID: # 22249165  2012. EMBO reports. 13: 258-65.

PMID: # 21914774  2011. Endocrinology. 152: 4138-47.

PMID: # 17785501  2007. American journal of physiology. Endocrinology and metabolism. 293: E1335-40.

Ciatazioni 1 a4 di 4 totali
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getContent, 104ms
  • QUESTIONS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;
  • bvseo_sdk, java_sdk, bvseo-3.2.0
  • CLOUD, getReviews, 11ms
  • REVIEWS, PRODUCT
  • bvseo-msg: The resource to the URL or file is currently unavailable.;