Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Fusion Protein Tags » GST Antibodies » GST Antibody (1-109): sc-33613

GST Antibody (1-109): sc-33613

 |  Datasheet

(Based on data analysis)

  • GST Antibody (1-109) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-109 mapping at the N-terminus of GST of Schistosoma japonicum origin
  • recommended for detection of GST fusion proteins and glutathione-S-transferase (GST) of Schistosoma japonicum origin by WB, IP, IF and ELISA
  • See 5 citations for GST Antibody (1-109)
 
Full-length GST protein sequence with immunogen highlighted:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

See additional GST Antibodies.

Also see GST Inhibitors or GST Activators for functional analysis of cellular responses to GST.


Ordering InformationProduct Citations
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
GST Antibody (1-109) sc-33613 200 µg/ml $279
 WB Control Recombinant Protein (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
GST (1-218) sc-4033 50 µg $167

Plasmid vectors for the expression of coding regions of eukaryotic genes in E. coli are in common usage; such expression vectors often encode hybrid fusion proteins containing part prokaryotic and part eukaryotic specified proteins. For instance, the pGEX.3X expression vector developed by Smith and Johnson allows for synthesis of fusion proteins between glutathionine-S-transferase (GST) and proteins encoded by inserted cDNA sequences. Antibodies derived from these GST fusion proteins are useful for checking protein expression both in plaques and on Western blots as well as for immunoaffinity purification of proteins expressed in E. coli.

GST Antibody (1-109) Product Citations
See how others have used GST Antibody (1-109) and or GST Antibody (1-109) conjugates.


5 total citations
Loading citations.
 
GST Antibody (1-109) Data
Click on image to enlarge
sc-33613
GST (1-109): sc-33613. Western blot analysis of recombinant GST under reducing conditions.
sc-33613
GST (1-109): sc-33613. Western blot analysis of S. japonicum recombinant GST.
Download
Datasheets
Get Adobe Acrobat Reader