¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Marcadores de Proteinas de Fusión » GFP Anticuerpos » GFP Antibody (B-2): sc-9996

GFP Anticuerpo(B-2): sc-9996

 |  Ficha Técnica

(Basado en el análisis de datos)

  • GFP Antibody (B-2) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-238 representing full length GFP (green fluorescent protein) of Aequorea victoria origin
  • recommended for detection of GFP and GFP mutant fusion proteins by WB, IP, IF, FCM and ELISA
  • agarose conjugate for IP studies, sc-9996 AC, 500 µg/0.25 ml agarose
  • HRP conjugate, sc-9996 HRP, 200 µg/ml
  • biotin conjugate, sc-9996 B, 200 µg/ml
  • fluorescein (sc-9996 FITC) and rhodamine (sc-9996 TRITC) conjugates for immunofluorescence, 200 µg/ml
  • Alexa Fluor® 405 (sc-9996 AF405), Alexa Fluor® 488 (sc-9996 AF488) and Alexa Fluor® 647 (sc-9996 AF647) conjugates for FCM or immunofluorescence; 100 µg/2 ml
  • phycoerythrin (sc-9996 PE), PerCP (sc-9996 PerCP) and PerCP-Cy5.5 (sc-9996 PCPC5) conjugates for FCM, 100 tests
  • See 266 citations for GFP Anticuerpo (B-2)
 
Secuencia completa de la proteína para GFP con inmunógeno inidcado:
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELY

Ver tambiénGFP Antibodies.

Información sobre pedidosMenciones del Producto
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   FCM  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GFP Antibody (B-2) sc-9996 200 µg/ml $279
GFP Antibody (B-2) AC sc-9996 AC 500 µg/ml, 25% ag $366
GFP Antibody (B-2) Alexa Fluor® 405 sc-9996 AF405 100 µg/2 ml $314
GFP Antibody (B-2) Alexa Fluor® 488 sc-9996 AF488 100 µg/2 ml $314
GFP Antibody (B-2) Alexa Fluor® 647 sc-9996 AF647 100 µg/2 ml $314
GFP Antibody (B-2) B sc-9996 B 200 µg/ml $282
GFP Antibody (B-2) FITC sc-9996 FITC 200 µg/ml $282
GFP Antibody (B-2) HRP sc-9996 HRP 200 µg/ml $279
GFP Antibody (B-2) PCPC5 sc-9996 PCPC5 100 tests in 2 ml $310
GFP Antibody (B-2) PE sc-9996 PE 100 tests in 2 ml $303
GFP Antibody (B-2) PerCP sc-9996 PerCP 100 tests in 2 ml $310
GFP Antibody (B-2) TRITC sc-9996 TRITC 200 µg/ml $282

The green fluorescent protein (GFP) was originally identified as a protein involved in the bioluminescence of the jellyfish Aequorea victoria. GFP cDNA produces a fluorescent product when expressed in prokaryotic cells, without the need for exogenous substrates or cofactors, making GFP a useful tool for monitoring gene expression and protein localization in vivo. Several GFP mutants have been developed, including EGFP, which fluoresce more intensely than the wildtype GFP and have shifted excitation maxima, making them useful for FACS and fluorescence microscopy as well as double-labeling applications. GFP is widely used in expression vectors as a fusion protein tag, allowing expression and monitoring of heterologous proteins fused to GFP.

GFP Antibody (B-2) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados GFP (B-2).


266 menciones totales
Cargando las citaciones
 
GFP Antibody (B-2) Data
Haga click en la imágen para agrandarla
sc-9996
GFP (B-2): sc-9996. Western blot analysis of GFP expression in COS (A) and GFP transfected COS (B) cell lysates.
sc-9996
GFP (B-2): sc-9996. Immunofluorescence staining of methanol-fixed COS cells transfected with GFP fusion protein showing cytoplasmic staining.
sc-9996
pCruz GFP-Lac Z: sc-5046. Western blot analysis of GFP expression in control COS cells (A) and COS cells transfected with GFP-Lac Z (B). Blot probed with GFP (B-2): sc-9996.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader