¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Kinasas y fosfatasas  » SGK Anticuerpos » SGK3 Antibody (H-95): sc-98973

SGK3 Anticuerpo(H-95): sc-98973

 |  Ficha Técnica

(Basado en el análisis de datos)
  • SGK3 Antibody (H-95) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 67-145 mapping near the N-terminus of SGK3 of human origin
  • recommended for detection of SGK3 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and avian
 
Secuencia completa de la proteína para SGK3 con inmunógeno inidcado:
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

Ver tambiénSGK AntibodiesincluyebdoSGK, SGK2, SGK3ySgk223.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SGK3 Antibody (H-95) sc-98973 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SGK3 siRNA (h) sc-44852 10 µM $258
SGK3 siRNA (m) sc-44853 10 µM $258
SGK3 siRNA (h)-PR sc-44852-PR 10 µM, 20 µl $23
SGK3 siRNA (m)-PR sc-44853-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SGK3 shRNA Plasmid (h) sc-44852-SH 20 µg $520
SGK3 shRNA Plasmid (m) sc-44853-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SGK3 siRNA shRNA (h) Lentiviral Particles sc-44852-V 200 µl $625
SGK3 siRNA shRNA (m) Lentiviral Particles sc-44853-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
A-375 Cell Lysate sc-3811 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano SGK3 23678 8q13.1 Q96BR1
 607591
Ratón Sgk3 170755 1 A2 Q9ERE3
 No Disponible
 

Serine/threonine-protein kinase Sgk3 (SGK3), also designated serum/glucocorticoid regulated kinase 3, belongs to the Ser/Thr protein kinase family of proteins. The serum- and glucocorticoid-regulated kinase proteins are closely related to the Akt protein family. SGK1, a homolog of SGK3, activates ion channels, in particular potassium (K+) channels. SGK2 and SGK3 have been found to also be involved in this activation process, making all three of these proteins important regulators for cell proliferation, epithelial transport and neuromuscular excitability. SGK3 acts as a mediator of IL-3 dependent survival signals in the cell. It localizes to the early endosome and in vesicle-like structures. SGK3 is a widely expressed protein, but it is primarily detected in kidney, liver, pancreas, brain and heart. Phosphorylation of SGK3 at residue Ser 486 leads to an increase in SGK3 activation.