¡Bienvenido a Santa Cruz Biotechnology!

QDPR Anticuerpo(H-234): sc-98349

 |  Ficha Técnica

(Basado en el análisis de datos)

  • QDPR Antibody (H-234) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 11-244 mapping at the C-terminus of QDPR of human origin
  • recommended for detection of QDPR of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including canine and porcine
 
Secuencia completa de la proteína para QDPR con inmunógeno inidcado:
MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF

Ver tambiénQDPR Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
QDPR Antibody (H-234) sc-98349 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
QDPR siRNA (h) sc-89106 10 µM $258
QDPR siRNA (m) sc-106467 10 µM $258
QDPR (h)-PR sc-89106-PR 10 µM, 20 µl $23
QDPR (m)-PR sc-106467-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
QDPR shRNA Plasmid (h) sc-89106-SH 20 µg $520
QDPR shRNA Plasmid (m) sc-106467-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
QDPR shRNA (h) Lentiviral Particles sc-89106-V 200 µl $625
QDPR shRNA (m) Lentiviral Particles sc-106467-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HL-60 Whole Cell Lysate sc-2209 500 µg/200 µl $104
QDPR (m): 293T Lysate sc-122863 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano QDPR 5860 4p15.32 P09417
261630
Ratón Qdpr 110391 5 B3 Q8BVI4
No Disponible
 


QDPR (quinoid dihydropteridine reductase), also known as DHPR (dihydropteridine reductasae) or PKU2, is a member of the short-chain dehydrogenases/reductase (SDR) family of enzymes. Functioning as a homodimer, QDPR plays an important role in the recycling of tetrahydrobiopterin (BH4), an essential cofactor for the hydroxylation of the aromatic amino acids (tryptophan, tyrosine and phenylalanine). More specifically, QDPR catalyzes the regeneration of BH4 from quinonoid dihydrobiopterin (qBH2), the product generated from the hydroxylation reactions. Mutations in the gene encoding QDPR can lead to phenylketonuria II (also called PK2 or dihydropteridine reductase deficiency), a disorder resulting from the depletion of dopamine, epinephrine and serotonin due to defective recycling of BH4. Symptoms of PK2 include hyperphenylalaninemia, axial hypotonia, truncal hypertonia, microcephaly and abnormal thermogenesis.

QDPR Antibody (H-234) Data
Haga click en la imágen para agrandarla
QDPR (H-234): sc-98349. Western blot analysis of QDPR expression in HL-60 whole cell lysate.
QDPR (H-234): sc-98349. Western blot analysis of QDPR expression in non-transfected: sc-117752 (A) and mouse QDPR transfected: sc-122863 (B) 293T whole cell lysates.
QDPR (H-234): sc-98349. Western blot analysis of QDPR expression in non-transfected: sc-117752 (A) and mouse QDPR transfected: sc-122863 (B) 293T whole cell lysates.
QDPR (H-234): sc-98349. Western blot analysis of QDPR expression in non-transfected: sc-117752 (A) and human QDPR transfected: sc-159818 (B) 293T whole cell lysates.
Descargar