¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Kinasas y fosfatasas  » p38 Anticuerpos » p38α/β Antibody (A-12): sc-7972

p38α/β Anticuerpo(A-12): sc-7972

 |  Ficha Técnica

(Basado en el análisis de datos)

  • p38α/β Antibody (A-12) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 213-360 mapping at the C-terminus of p38α of human origin
  • recommended for detection of p38α and p38β of mouse, rat and human origin by WB, IP, IF, UHC(P), FCM and ELISA; also reactive with additional species, including equine and porcine
  • agarose conjugate for IP studies, sc-7972 AC, 500 µg/0.25 ml agarose
  • fluorescein (sc-7972 FITC) and rhodamine (sc-7972 TRITC) conjugates for immunofluorescence, 200 µg/ml
  • Alexa Fluor® 405 (sc-7972 AF405), Alexa Fluor® 488 (sc-7972 AF488) and Alexa Fluor® 647 (sc-7972 AF647) conjugates for FCM or immunofluorescence; 100 µg/2 ml
  • See 66 citations for p38α/β Anticuerpo (A-12)
 
Secuencia completa de la proteína para p38α/β con inmunógeno inidcado:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Ver tambiénp38 Antibodiesincluyebdop38, p38 alpha, p38 betayp38 gamma.

También verp38 alpha Inhibitorsop38 alpha Activators for functional analysis of cellular responses to p38 alpha and p38 beta.


Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   FCM  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
p38α/β Antibody (A-12) sc-7972 200 µg/ml $279
p38α/β Antibody (A-12) AC sc-7972 AC 500 µg/ml, 25% ag $366
p38α/β Antibody (A-12) Alexa Fluor® 405 sc-7972 AF405 100 µg/2 ml $314
p38α/β Antibody (A-12) Alexa Fluor® 488 sc-7972 AF488 100 µg/2 ml $314
p38α/β Antibody (A-12) Alexa Fluor® 647 sc-7972 AF647 100 µg/2 ml $314
p38α/β Antibody (A-12) FITC sc-7972 FITC 200 µg/ml $282
p38α/β Antibody (A-12) TRITC sc-7972 TRITC 200 µg/ml $282
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
p38α (h): 293T Lysate sc-114258 100 µg/200 µl $205
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
p38α (m): 293T Lysate sc-122319 100 µg/200 µl $205
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano MAPK14 1432 6p21.31 NM_001315, NM_139012, NM_139013, NM_139014 Q16539
 600289
Humano MAPK11 5600 22q13.33 Q15759
 602898
Ratón Mapk11 19094 15 E3 Q9WUI1
 No Disponible
Ratón Mapk14 26416 17 A3.3 P47811
 No Disponible
 

MAP (mitogen-activated protein) kinases play a significant role in many biological processes, including cell adhesion and spreading, cell differentiation and apoptosis. p38å, p38∫ and p38©, also known as MAPK14, MAPK11 and MAPK12, respectively, each contain one protein kinase domain and belong to the MAP kinase family. Expressed in different areas throughout the body with common expression patterns in heart, p38 proteins use magnesium as a cofactor to catalyze the ATP-dependent phosphorylation of target proteins. Via their catalytic activity, p38å, p38∫ and p38© are involved in a variety of events throughout the cell, including signal transduction pathways, cytokine production and cell proliferation and differentiation. The p38 proteins are subject to phosphoryation on Thr and Tyr residues, an event which is thought to activate the phosphorylated protein.

p38α/β Antibody (A-12) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados p38α/β (A-12).


65 menciones totales
Cargando las citaciones
 
p38α/β Antibody (A-12) Data
Haga click en la imágen para agrandarla
sc-7972
p38α/β (A-12): sc-7972. Western blot analysis of p38α expression in Jurkat (A) and NIH/3T3 (B) whole cell lysates.
sc-7972
p38α/β (A-12) Alexa Fluor 488: sc-7972 AF488. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-7972
p38α/β (A-12) Alexa Fluor 488: sc-7972 AF488. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-3890.
sc-7972
p38α/β (A-12): sc-7972. Immunoperoxidase staining of formalin fixed, paraffin-embedded human skeletal muscle tissue showing cytoplasmic staining of myocytes.
sc-7972
p38α/β (A-12): sc-7972. Western blot analysis of p38α expression in non-transfected 293T: sc-117752 (A), human p38α transfected 293T: sc-114258 (B) and Jurkat (C) whole cell lysates.
sc-7972
p38α/β (A-12): sc-7972. Western blot analysis of p38α expression in Jurkat (A) and NIH/3T3 (B) whole cell lysates.
sc-7972
p38 siRNA (h): sc-29433. Western blot analysis of p38 expression in non-transfected control (A) and p38 transfected (B) Jurkat cells. Blot probed with p38α/β (A-12): sc-7972. γ Tubulin (C-11): sc-17787 used as specificity and loading control.
sc-7972
p38α/β (A-12) Alexa Fluor 488: sc-7972 AF488. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-7972
p38α/β (A-12) Alexa Fluor 488: sc-7972 AF488. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-3890.
sc-7972
p38 (A-12): sc-7972. Western blot analysis of p38α expression in non-transfected 293T: sc-117752 (A), human p38α transfected 293T: sc-114258 (B) and Jurkat (C) whole cell lysates.
sc-7972
p38α/β (A-12): sc-7972. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
sc-7972
p38α/β (A-12) AF647: sc-7972 AF647. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-24636.
sc-7972
p38α/β (A-12): sc-7972. Western blot analysis ofp38α/β expression in Jurkat (A) and NIH/3T3 (B) whole cell lysates.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader