¡Bienvenido a Santa Cruz Biotechnology!

β-Arrestin-1/2 Anticuerpo(A-1): sc-74591

 |  Ficha Técnica

(Basado en el análisis de datos)

  • β-Arrestin-1/2 Antibody (A-1) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 7-290 mapping near the N-terminus of β-Arrestin-1 of human origin
  • recommended for detection of β-Arrestin-1, and 2, and to a lesser extent, S-Arrestin of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including porcine
 
Secuencia completa de la proteína para β-Arrestin-1/2 con inmunógeno inidcado:
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Ver tambiénArrestin AntibodiesincluyebdoArrestin, Arrestin-C, beta-Arrestin-1, Visual Arrestinybeta-Arrestin-2.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
β-Arrestin-1/2 Antibody (A-1) sc-74591 200 µg/ml $279
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
PC-12 Cell Lysate sc-2250 500 µg/200 µl $104
SK-N-MC Cell Lysate sc-2237 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
A549 Cell Lysate sc-2413 500 µg/200 µl $104
RAW 264.7 Whole Cell Lysate sc-2211 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano ARRB1 408 11q13.4 P49407
107940
Humano ARRB2 409 17p13.2 P32121
107941
Ratón Arrb1 109689 7 E2 Q8BWG8
No Disponible
Ratón Arrb2 216869 11 B3 Q91YI4
No Disponible
 


The members of the G protein coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin and dopamine receptors (1). The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds (2,3). Members of the ∫-Arrestin family regulate receptor binding to G proteins (4). ∫-Arrestins have been found to be located at postsynaptic sites, where they are thought to act in concert with ∫ARK (∫ARK1, also designated GRK 2, or ∫ARK2, also designated GRK 3) to regulate G protein-coupled neurotransmitter receptors. Expression of ∫-Arrestin-1 and b-Arrestin-2 is seen predominantly in spleen and neuronal tissues (5). It has been shown that ∫-Arrestin-1 expression is modulated by intracellular cAMP, which may be a novel mechanism for the regulation of receptor-mediated responses (6).

β-Arrestin-1/2 Antibody (A-1) Data
Haga click en la imágen para agrandarla
β-Arrestin-1/2 (A-1): sc-74591. Western blot analysis of β-Arrestin-1/2 expression in RAW 264.7 (A) and PC-12 (B) whole cell lysates.
b-Arrestin-1/2 (A-1): sc-74591. Western blot analysis of b-Arrestin-1/2 expression in SK-N-MC (A), Hep G2 (B), T84 (C), NTERA-2 cl.D1 (D) and A549 (E) whole cell lysates.
β-Arrestin-1/2 (A-1): sc-74591. Immunoperoxidase staining of formalin fixed, paraffin-embedded human kidney tissue showing cytoplasmic staining of glomerular cells.
Descargar