¡Bienvenido a Santa Cruz Biotechnology!

Rab 27a Anticuerpo(E-8): sc-74586

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Rab 27a Antibody (E-8) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 162-221 mapping at the C-terminus of Rab 27a of human origin
  • recommended for detection of Rab 27a and, to a lesser extent, Rab 27b of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para Rab 27a con inmunógeno inidcado:
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFRPKRVVYRASGPDGPVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Ver tambiénRab AntibodiesincluyebdoRab, Rab 1, Rab 15, Rab 17, Rab 1A, Rab 1B, Rab 26, Rab 30, Rab 35, Rab 37, Rab 39B, Rab 3C, Rab 40AL, Rab 41, Rab 44, Rab 6B, Rab 6C, Rab L2A, Rab L5, Rab 2, Rab 2A, Rab 2B, Rab L2B, Rab 3, Rab 3A, Rab 3B, Rab 3D, Rab L3, Rab 4, Rab 4A, Rab 4B, Rab L4, Rab 5, Rab 5A, Rab 5B, Rab 5C, Rab 6, Rab 6A, Rab 7, Rab 7b, Rab 8, Rab 8A, Rab 8B, Rab 9, Rab 9A, Rab 9B, Rab 10, Rab 11, Rab 11A, Rab 11B, Rab 12, Rab 13, Rab 14, Rab 16, Rab 18, Rab 19, Rab 20, Rab 21, Rab 22A, Rab 23, Rab 24, Rab 25, Rab 27a, Rab 27b, Rab 28, Rab 31, Rab 32, Rab 33A, Rab 33B, Rab 34, Rab 36, Rab 38, Rab 40A, Rab 40B, Rab 40C, Rab 42, Rab 43, Rab 45yRab 7L1.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rab 27a Antibody (E-8) sc-74586 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rab 27a siRNA (h) sc-41834 10 µM $258
Rab 27a (h)-PR sc-41834-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rab 27a shRNA Plasmid (h) sc-41834-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rab 27a shRNA (h) Lentiviral Particles sc-41834-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rab 27a (m): 293T Lysate sc-122891 100 µg/200 µl $205
HL-60 Whole Cell Lysate sc-2209 500 µg/200 µl $104
Rab 27a (m2): 293T Lysate sc-122892 100 µg/200 µl $205
Rab 27a (h): 293T Lysate sc-111961 100 µg/200 µl $205
SK-MEL-28 Cell Lysate sc-2236 500 µg/200 µl $104
C32 Whole Cell Lysate sc-2205 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano RAB27A 5873 15q21.3 P51159
607624
Ratón Rab27a 11891 9 D Q9ERI2
No Disponible
 


The Rab family of low molecular weight GTPases are critical regulators of vesicular transport (1). Rab proteins cycle between an active GTP-bound state, which recruits specific effector proteins, and an inactive GDP-bound state (1). Two members of this family, Rab27a and Rab27b, have overlapping functions, but differ in tissue specificity (2,3). Rab27a is widely expressed with significant expression in pancreatic islets and pituitary tissue, and low expression in brain (3). Rab27b is also expressed in pituitary tissue, but is more significantly expressed in brain and spleen (3). Rab27a regulates diverse processes involving lysosome-related organelles, including melanosome motility in melanocytes and lytic granule release in cytotoxic T lymphocytes (4). Mutations in the Rab27a gene result in Griscelli syndrome (GS) or the corresponding mouse model ashen, a rare autosomal recessive disorder characterized by hypopigmentation, prolonged bleeding times, and platelet storage pool deficiency (2,4). In GS, Rab27a is not available to mediate the recruitment of melanosomes via the actin motor, myosin Va (5,6). The human Rab27b gene maps to chromosome 18q21.1, and encodes a protein that is involved in pituitary hormone secretion (3,7). Rab27b may be functionally redundant to Rab27a, as it can rescue Rab27a mutants (2).

Rab 27a Antibody (E-8) Data
Haga click en la imágen para agrandarla
Rab 27a (E-8): sc-74586. Western blot analysis of Rab 27a expression in SK-MEL-28 whole cell lysate.
Rab 27a (E-8): sc-74586. Western blot analysis of Rab 27a expression in C32 whole cell lysate.
Rab 27a (E-8): sc-74586. Western blot analysis of Rab 27a expression in non-transfected: sc-117752 (A) and mouse Rab 27a transfected: sc-122891 (B) 293T whole cell lysates.
Rab 27a (E-8): sc-74586. Western blot analysis of Rab 27a expression in non-transfected: sc-117752 (A) and mouse Rab 27a transfected: sc-122892 (B) 293T whole cell lysates.
Rab 27a (E-8): sc-74586. Western blot analysis of Rab 27a expression in non-transfected 293T: sc-117752 (A), human Rab 27a transfected 293T: sc-111961 (B) and HL-60 (C) whole cell lysates.
Rab 27a (E-8): sc-74586. Immunoperoxidase staining of formalin fixed, paraffin-embedded human stomach tissue showing cytoplasmic staining of glandular cells.
Descargar