¡Bienvenido a Santa Cruz Biotechnology!

Bcl-2 Anticuerpo(C-2): sc-7382

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Bcl-2 Antibody (C-2) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-205 of human Bcl-2
  • recommended for detection of Bcl-2 of mouse, rat and human origin by WB, IP, IF, IHC(P) and FCM
  • agarose conjugate for IP studies, sc-7382 AC, 500 µg/0.25 ml agarose
  • HRP conjugate, sc-7382 HRP, 200 µg/ml
  • fluorescein (sc-7382 FITC) and rhodamine (sc-7382 TRITC) conjugates for immunofluorescence, 200 µg/ml
  • phycoerythrin (sc-7382 PE), PerCP (sc-7382 PerCP) and PerCP-Cy5.5 (sc-7382 PCPC5) conjugates for intracellular FCM, 100 tests
  • Alexa Fluor® 405 (sc-7382 AF405), Alexa Fluor® 488 (sc-7382 AF488) and Alexa Fluor® 647 (sc-7382 AF647) conjugates for FCM or immunofluorescence; 100 µg/2 ml
  • See 310 citations for Bcl-2 Anticuerpo (C-2)
 
Secuencia completa de la proteína para Bcl-2 con inmunógeno inidcado:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Ver tambiénBcl-2 Antibodies.

También verBcl-2 Inhibitors for functional analysis of cellular responses to Bcl-2.


Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   FCM   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Bcl-2 Antibody (C-2) sc-7382 200 µg/ml $279
Bcl-2 Antibody (C-2) AC sc-7382 AC 500 µg/ml, 25% ag $366
Bcl-2 Antibody (C-2) Alexa Fluor® 405 sc-7382 AF405 100 µg/2 ml $314
Bcl-2 Antibody (C-2) Alexa Fluor® 488 sc-7382 AF488 100 µg/2 ml $314
Bcl-2 Antibody (C-2) Alexa Fluor® 647 sc-7382 AF647 100 µg/2 ml $314
Bcl-2 Antibody (C-2) FITC sc-7382 FITC 200 µg/ml $282
Bcl-2 Antibody (C-2) HRP sc-7382 HRP 200 µg/ml $279
Bcl-2 Antibody (C-2) PCPC5 sc-7382 PCPC5 100 tests in 2 ml $310
Bcl-2 Antibody (C-2) PE sc-7382 PE 100 tests in 2 ml $303
Bcl-2 Antibody (C-2) PerCP sc-7382 PerCP 100 tests in 2 ml $310
Bcl-2 Antibody (C-2) TRITC sc-7382 TRITC 200 µg/ml $282
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Bcl-2 siRNA (h) sc-29214 10 µM $258
Bcl-2 siRNA (m) sc-29215 10 µM $258
Bcl-2 siRNA (h2) sc-61899 10 µM $258
Bcl-2 (h)-PR sc-29214-PR 10 µM, 20 µl $23
Bcl-2 (m)-PR sc-29215-PR 10 µM, 20 µl $23
Bcl-2 (h2)-PR sc-61899-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Bcl-2 shRNA Plasmid (h) sc-29214-SH 20 µg $520
Bcl-2 shRNA Plasmid (m) sc-29215-SH 20 µg $520
Bcl-2 shRNA Plasmid (h2) sc-61899-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Bcl-2 shRNA (h) Lentiviral Particles sc-29214-V 200 µl $625
Bcl-2 shRNA (m) Lentiviral Particles sc-29215-V 200 µl $625
Bcl-2 shRNA (h2) Lentiviral Particles sc-61899-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
WEHI-231 Whole Cell Lysate sc-2213 500 µg/200 µl $104
U-937 Cell Lysate sc-2239 500 µg/200 µl $104
HL-60 Whole Cell Lysate sc-2209 500 µg/200 µl $104
Bcl-2 (h): 293T Lysate sc-176463 100 µg/200 µl $205
mouse spleen extract sc-2391 500 µg/200 µl $104
rat spleen extract sc-2397 500 µg/200 µl $104
Bcl-2 (m): 293T Lysate sc-118779 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano BCL2 596 18q21.33 NM_000633, NM_000657 P10415
151430
Ratón Bcl2 12043 1 E2.1 P10417
No Disponible
 


Apoptosis is defined as a set of cascades which, when initiated, programs the cell to undergo lethal changes such as membrane blebbing, mitochondrial break down and DNA fragmentation. Bcl-2 is one among many key regulators of apoptosis, which are essential for proper development, tissue homeostasis, and protection against foreign pathogens. Human Bcl-2 is an anti-apoptotic, membrane-associated oncoprotein that can promote cell survival through protein-protein interactions with other Bcl-2 related family members, such as the death suppressors Bcl-xl, Mcl-1, Bcl-w, and A1 or the death agonists Bax, Bak, Bik, Bad, and Bid. The anti-apoptotic function of Bcl-2 can also be regulated through proteolytic processing and phospho-rylation. Bcl-2 may promote cell survival by interfering with the activation of the cytochrome c/Apaf-1 pathway through stabilization of the mitochondrial membrane. Mutations in the Bcl-2 gene can contribute to cancers where normal physiological cell death mechanisms are compromised by deregulation of the anti-apoptotic influence of Bcl-2.

Bcl-2 Antibody (C-2) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados Bcl-2 (C-2).


309 menciones totales
Cargando las citaciones
 
Bcl-2 Antibody (C-2) Data
Haga click en la imágen para agrandarla
Bcl-2 (C-2) PE: sc-7382 PE. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-2866.
Western blot analysis of Bcl-2 expression in HL-60 (A,D), Jurkat (B,E) and WEHI-231 (C,F) whole cell lysates. Antibodies tested include Bcl-2 (C-2): sc-7382 (A-C) and Bcl-2 (100): sc-509 (D-F).
Bcl-2 (C-2): sc-7382. Immunoperoxidase staining of formalin-fixed, paraffin-embedded normal human colon tissue showing cytoplasmic staining of lymphoid cells (A). Immunofluorescence staining of methanol-fixed HL-60 cells showing cytoplasmic localization (B).
Bcl-2 (C-2) Alexa Fluor 647: sc-7382 AF647. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-24636.
Bcl-2 (C-2): sc-7382. Western blot analysis of Bcl-2 expression in non-transfected 293T: sc-117752 (A), mouse Bcl-2 transfected 293T: sc-118779 (B) and Jurkat (C) whole cell lysates.
Western blot analysis of Bcl-2 phosphorylation in untreated (A,C), and paclitaxel treated (B,D) Jurkat whole cell lysates. Antibodies tested include p-Bcl-2 (74.Ser 70): sc-135757 (A,B) and Bcl-2 (C-2): sc-7382 (C,D).
Bcl-2 (C-2): sc-7382. Western blot analysis of Bcl-2 expression in non-transfected: sc-117752 (A) and human Bcl-2 transfected: sc-176463 (B) 293T whole cell lysates.
Bcl-2 (C-2) FITC: sc-7382 FITC. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG1: sc-2855.
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant p38α treated (B,E) and human recombinant p38α and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-Bcl-2 (Thr 74)-R: sc-16322-R (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant p38α treated (B,E) and human recombinant p38α and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-p-Bcl-2 (Ser 87)-R: sc-16323-R (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant p38α treated (B,E) and human recombinant p38α and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-Bcl-2 (Thr 56)-R: sc-16321-R (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant ERK 2 treated (B,E) and human recombinant ERK 2 and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-Bcl-2 (Thr 74)-R: sc-16322-R (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant ERK 2 treated (B,E) and human recombinant ERK 2 and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-Bcl-2 (Ser 87)-R: sc-16323-R (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), human recombinant ERK 2 treated (B,E) and human recombinant ERK 2 and lambda protein phosphatase treated (C,F) human recombinant Bcl-2 fusion proteins. Antibodies tested include p-Bcl-2 (A-3): sc-377513 (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), paclitaxel treated (B,E) and paclitaxel and lambda protein phosphatase (sc-200312A) treated (C,F) Jurkat whole cell lysates. Antibodies tested include p-Bcl-2 (367.Ser 70): sc-293128 (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Western blot analysis of Bcl-2 phosphorylation in untreated (A,D), paclitaxel treated (B,E) and paclitaxel and lambda protein phosphatase (sc-200312A) treated (C,F) Jurkat whole cell lysates. Antibodies tested include p-Bcl-2 (662.Ser 70): sc-293129 (A,B,C) and Bcl-2 (C-2): sc-7382 (D,E,F).
Bcl-2 (C-2): sc-7382. Western blot analysis of Bcl-2 expression in Jurkat whole cell lysate.
Descargar