¡Bienvenido a Santa Cruz Biotechnology!

Skp1 p19 Anticuerpo(H-163): sc-7163

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Skp1 p19 Antibody (H-163) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-163 representing full length Skp1 p19 of human origin
  • recommended for detection of Skp1 p19 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and avian
  • agarose conjugate for IP studies, sc-7163 AC, 500 µg/0.25 ml agarose
  • See 17 citations for Skp1 p19 Anticuerpo (H-163)
 
Secuencia completa de la proteína para Skp1 p19 con inmunógeno inidcado:
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEE

Ver tambiénSkp Antibodies.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Skp1 p19 Antibody (H-163) sc-7163 200 µg/ml $279
Skp1 p19 Antibody (H-163) AC sc-7163 AC 500 µg/ml, 25% ag $366
Skp1 p19 (H-163) sc-7163 P
(peptide)
100 µg/0.5 ml $61
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Skp1 p19 siRNA (h) sc-29482 10 µM $258
Skp1 p19 siRNA (m) sc-36498 10 µM $258
Skp1 p19 (h)-PR sc-29482-PR 10 µM, 20 µl $23
Skp1 p19 (m)-PR sc-36498-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Skp1 p19 shRNA Plasmid (h) sc-29482-SH 20 µg $520
Skp1 p19 shRNA Plasmid (m) sc-36498-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Skp1 p19 shRNA (h) Lentiviral Particles sc-29482-V 200 µl $625
Skp1 p19 shRNA (m) Lentiviral Particles sc-36498-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
A-431 Whole Cell Lysate sc-2201 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
mouse brain extract sc-2253 500 µg/200 µl $104
Skp1 p19 (h): 293T Lysate sc-114049 100 µg/200 µl $205
Skp1 p19 (m): 293T Lysate sc-126001 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano SKP1A 6500 5q31.1 NM_006930, NM_170679 P63208
601434
Ratón Skp1a 21402 11 B1.3 Q9WTX5
No Disponible
 


The critical role that the family of regulatory proteins known as cyclins plays in eukaryotic cell cycle regulation is well established. The best characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of MPF (maturation promoting factor). Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin dependent kinase-2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DP-1 and E2F and retino-blastoma protein p110. Two cyclin A-Cdk2 complex binding proteins, Skp1 p19 and Skp2 p45, have been described. Although the Skps (S phase kinase-associated proteins) associate with the active cyclin A-Cdk2 complex, they do not exhibit any regulatory effects on the complex. Abolition of Skp2 p45 function by either microinjection of anti-p45 antibodies or addition of antisense oligonucleotides prevents entry into S phase of both normal and transformed cells.

Skp1 p19 Antibody (H-163) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados Skp1 p19 (H-163).


17 menciones totales
Cargando las citaciones
 
Skp1 p19 Antibody (H-163) Data
Haga click en la imágen para agrandarla
Skp1 p19 (H-163): sc-7163. Immunoperoxidase staining of formalin-fixed, paraffin-embedded human breast tumor showing nuclear staining.
Skp1 p19 (H-163): sc-7163. Western blot analysis of Skp1 p19 expression in non-transfected: sc-117752 (A) and human Skp1 p19 transfected: sc-114049 (B) 293T whole cell lysates.
Skp1 p19 (H-163): sc-7163. Western blot analysis of Skp1 p19 expression in non-transfected: sc-117752 (A) and mouse Skp1 p19 transfected: sc-126001 (B) 293T whole cell lysates.
Skp1 p19 (H-163): sc-7163. Western blot analysis of Skp1 p19 expression in A-431 whole cell lysate.
Skp1 p19 (H-163): sc-7163. Western blot analysis of Skp1 p19 expression in mouse brain tissue extract.
Skp1 p19 (H-163): sc-7163. Immunoperoxidase staining of formalin fixed, paraffin-embedded human brain tissue showing nuclear and cytoplasmic staining of neuronal cells.
Descargar