¡Bienvenido a Santa Cruz Biotechnology!

ERGIC-53 Anticuerpo(H-245): sc-66880

 |  Ficha Técnica

(Basado en el análisis de datos)

  • ERGIC-53 Antibody (H-245) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 266-510 mapping at the C-terminus of ERGIC-53 of human origin
  • recommended for detection of ERGIC-53 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
  • See 3 citations for ERGIC-53 Anticuerpo (H-245)
 
Secuencia completa de la proteína para ERGIC-53 con inmunógeno inidcado:
MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF

Ver tambiénERGIC AntibodiesincluyebdoERGIC, ERGIC-1, ERGIC-53L, ERGIC-2, ERGIC-3yERGIC-53.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
ERGIC-53 Antibody (H-245) sc-66880 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
ERGIC-53 siRNA (h) sc-45246 10 µM $258
ERGIC-53 siRNA (m) sc-45247 10 µM $258
ERGIC-53 siRNA (h)-PR sc-45246-PR 10 µM, 20 µl $23
ERGIC-53 siRNA (m)-PR sc-45247-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
ERGIC-53 shRNA Plasmid (h) sc-45246-SH 20 µg $520
ERGIC-53 shRNA Plasmid (m) sc-45247-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
ERGIC-53 siRNA shRNA (h) Lentiviral Particles sc-45246-V 200 µl $625
ERGIC-53 siRNA shRNA (m) Lentiviral Particles sc-45247-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
MCF7 Whole Cell Lysate sc-2206 500 µg/200 µl $104
ERGIC-53 (h): 293T Lysate sc-114897 100 µg/200 µl $205
ERGIC-53 (m): 293T Lysate sc-120100 100 µg/200 µl $205
ERGIC-53 (h4): 293T Lysate sc-110115 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano LMAN1 3998 18q21.32 NM_005570 P49257
601567
Ratón Lman1 70361 18 E1 Q9D0F3
No Disponible
 


Lectin mannose-binding 1, also designated vesicular integral-membrane protein (VIP36) and lectin mannose-binding 2, also designated ER-Golgi intermediate compartment (ERGIC-53) comprise a family of membrane bound, ubiquitous proteins involved in the selective transport of newly synthesized glycoproteins from the endoplasmic reticulum (ER) to the ER-Golgi intermediate compartment (ERGIC). VIP36 acts as an intracellular lectin in the early secretory pathway. It is involved in the sorting and transport of glycoproteins carrying high mannose-type glycans. ERGIC-53, a mannose-specific lectin, recognizes sugar residues of glycoproteins and glycolipids. It mediates the sorting and recycling of proteins and/or lipids. Null expression of ERGIC-53, also designated LMAN1, results in a rare autosomal recessive bleeding disorder that causes combined deficiency of both coagulation factors V and VIII.

ERGIC-53 Antibody (H-245) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados ERGIC-53 (H-245).


3 menciones totales
Cargando las citaciones
 
ERGIC-53 Antibody (H-245) Data
Haga click en la imágen para agrandarla
ERGIC-53 (H-245): sc-66880. Western blot analysis of ERGIC-53 expression in HeLa whole cell lysate (A) and truncated human recombinant ERGIC-53 fusion protein (B).
ERGIC-53 (H-245): sc-66880. Western blot analysis of ERGIC-53 expression in non-transfected 293T: sc-117752 (A), human ERGIC-53 transfected 293T: sc-114897 (B) and HeLa (C) whole cell lysates.
ERGIC-53 (H-245): sc-66880. Western blot analysis of ERGIC-53 expression in non-transfected 293T: sc-117752 (A), mouse ERGIC-53 transfected 293T: sc-120100 (B) and HeLa (C) whole cell lysates.
ERGIC-53 (H-245): sc-66880. Western blot analysis of ERGIC-53 expression in non-transfected: sc-117752 (A) and human ERGIC-53 transfected: sc-110115 (B) 293T whole cell lysates.
ERGIC-53 (H-245): sc-66880. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
ERGIC-53 (H-245): sc-66880. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
ERGIC-53 (H-245): sc-66880. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
ERGIC-53 (H-245): sc-66880. Immunoperoxidase staining of formalin fixed, paraffin-embedded human brain tissue showing cytoplasmic staining of neuronal and glial cells.
ERGIC-53 (H-245): sc-66880. Immunoperoxidase staining of formalin fixed, paraffin-embedded human thyroid gland tissue showing cytoplasmic staining of glandular cells.
Descargar