¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » ProteÍnas de Homeodominio » Nanog Anticuerpos » Nanog Antibody (C-4): sc-376915

Nanog Anticuerpo(C-4): sc-376915

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Nanog Antibody (C-4) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 181-329 mapping at the C-terminus of Nanog of mouse origin
  • recommended for detection of Nanog of mouse origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para Nanog con inmunógeno inidcado:
MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI

Ver tambiénNanog Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Nanog Antibody (C-4) sc-376915 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Ratón Nanog 71950 6 F2 NM_028016, XM_001471588 Q80Z64
 No Disponible
 

Nanog (from “Tir Na Nog,” the mythologic Celtic land of the ever young) is a divergent homeodomain protein that directs pluripotency and differentiation of undifferentiated embryonic stem cells. Nanog mRNA is present in pluripotent mouse and human cell lines and absent from differentiated cells. Human Nanog protein shares 52% overall amino acid identity with the mouse protein and 85% identity in the homeodomain. Human Nanog maps to gene locus 12p13.31, whereas mouse Nanog maps to gene loci 6 F2. Murine embryonic Nanog expression is detected in the inner cell mass of the blastocyst. High levels of human Nanog expression have been detected by Northern analysis in the undifferentiated NTERA-2 cl.D1 embryonal carcinoma cell line.
Nanog Antibody (C-4) Data
Haga click en la imágen para agrandarla
sc-376915
Nanog (C-4): sc-376915. Western blot analysis of Nanog expression in F9 whole cell lysate.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader