¡Bienvenido a Santa Cruz Biotechnology!

HAPLN2 Anticuerpo(F-7): sc-376797

 |  Ficha Técnica

(Basado en el análisis de datos)

 
Secuencia completa de la proteína para HAPLN2 con inmunógeno inidcado:
MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN

Ver tambiénHAPLN AntibodiesincluyebdoHAPLN, HAPLN1, HAPLN2, HAPLN3yHAPLN4.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HAPLN2 Antibody (F-7) sc-376797 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano HAPLN2 60484 1q21.3 NM_021817 Q9GZV7
n/a
 


HAPLN2 (hyaluronan and proteoglycan link protein 2, brain link protein 1) is a 340 amino acid protein encoded by the human gene HAPLN2. HAPLN2 belongs to the HAPLN family and contains one immunoglobulin (Ig)-like, V-type domain and two link domains. HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid. HAPLN2 is believed to play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS), which facilitates neuronal conduction and general structural stabilization. HAPLN2 may also be involved in the formation of extracellular matrices, contributing to perineuronal nets and facilitating the understanding of a functional role of these extracellular matrices. HAPLN2 is found in several nuclei throughout the midbrain and hindbrain in a perineuronal net pattern.

HAPLN2 Antibody (F-7) Data
Haga click en la imágen para agrandarla
HAPLN2 (F-7): sc-376797. Western blot analysis of HAPLN2 expression in non-transfected: sc-117752 (A) and human HAPLN2 transfected: sc-114486 (B) 293T whole cell lysates.
Descargar