¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Reguladores de Transcripción » hnRNP Anticuerpos » hnRNP A/B Antibody (G-10): sc-376411

hnRNP A/B Anticuerpo(G-10): sc-376411

 |  Ficha Técnica

(Basado en el análisis de datos)

  • hnRNP A/B Antibody (G-10) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-63 mapping at the N-terminus of hnRNP A/B of human origin
  • recommended for detection of hnRNP A/B of human origin by WB, IP, IF, IHC(P) and ELISA
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-376411 X, 200 µg/.01 ml
 
Secuencia completa de la proteína para hnRNP A/B con inmunógeno inidcado:
MSEAGEEQPMETTGATENGHEAVPEASRGRGWTGAAAGAGGATAAPPSGNQNGAEGDQINASNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY

Ver tambiénhnRNP AntibodiesincluyebdohnRNP, hnRNP A0, hnRNP D0, hnRNP A, hnRNP A1, hnRNP B, hnRNP B1, hnRNP C1, hnRNP CL1, hnRNP E1, hnRNP E3, hnRNP F, hnRNP H, hnRNP H2, hnRNP I, hnRNP J, hnRNP K, hnRNP L, hnRNP M, hnRNP Q, hnRNP R, hnRNP U, hnRNP UL1, hnRNP UL2, pan hnRNP, pan nRNP, hnRNP A2, hnRNP C2, hnRNP E2, hnRNP A3yhnRNP H3.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
hnRNP A/B Antibody (G-10) sc-376411 200 µg/ml $279
hnRNP A/B Antibody (G-10) X sc-376411 X 200 µg/0.1 ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano HNRNPAB 3182 5q35.3 NM_004499, NM_031266 Q99729
 602688
 

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport, and also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. The hnRNPs are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. hnRNP A/B (heterogeneous nuclear ribonucleoprotein A/B), also known as HNRNPAB, ABBP1 or HNRPAB, is a 332 amino acid nuclear protein that is ubiquitously expressed. hnRNP A/B binds single-stranded RNA and has a high affinity for G-rich and U-rich regions of hnRNA. hnRNP A/B contains two RRM (RNA recognition motif) domains and interacts with APOBEC1 (apolipoprotein B mRNA editing enzyme complex-1).
hnRNP A/B Antibody (G-10) Data
Haga click en la imágen para agrandarla
sc-376411
hnRNP A/B (G-10): sc-376411. Immunoperoxidase staining of formalin fixed, paraffin-embedded human spleen tissue showing nuclear staining of subset of cells in red and white pulps.
sc-376411
hnRNP A/B (G-10): sc-376411. Western blot analysis of hnRNP A/B expression in K-562 whole cell lysate.
sc-376411
hnRNP A/B (G-10): sc-376411. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader