¡Bienvenido a Santa Cruz Biotechnology!

Rho GDIα Anticuerpo(C-2): sc-374579

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Rho GDIα Antibody (C-2) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against a peptide mapping at the C-terminus of Rho GDIα of human origin
  • recommended for detection of Rho GDIå and, to a lesser extent, Ly-GDI of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Secuencia completa de la proteína para Rho GDIα con inmunógeno inidcado:
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

Ver tambiénRho GDI AntibodiesincluyebdoRho GDI, Lsc, Rho GDI alpha, Rho GDI gammayRhoGEF p115.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Rho GDIα Antibody (C-2) sc-374579 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano ARHGDIA 396 17q25.3 NM_001185077, NM_001185078, NM_004309 P52565
601925
 


Members of the Ras superfamily of small GTP-binding proteins are critical mediators of diverse cell signaling pathways, including those leading to cell proliferation, cytoskeletal organization and secretion. The counter-conversion of the active GTP-bound form of these proteins to their inactive GDP-bound form is influenced by two types of regulatory proteins: those that alter the intrinsic GTPase activity of the GTP-binding proteins and those that alter the rate of GDP/GTP exchange. Guanine nucleotide-releasing factors (GRFs) increase the GDP dissociation rate, while GDP-dissociation inhibitors (GDIs) decrease the dissociation rate. Rho GDIå, also known as ARHGDIA or GDIA1, is a 204 amino acid member of the Rho GDI family of proteins. Localized to the cytoplasm, Rho GDIå inhibits the dissociation of GDP from Rho proteins, thereby preventing GTP from binding to and subsequently activating Rho proteins. In humans, Rho GDIå can be phosphorylated at Ser 101 by p21-activated kinase (åPAK), an event that inhibits Rho GDIå activity and may result in positive feedback regulation of certain Rho GDIå target proteins.

Rho GDIα Antibody (C-2) Data
Haga click en la imágen para agrandarla
Rho GDIα (C-2): sc-374579. Western blot analysis of Rho GDIα expression in non-transfected 293: sc-110760 (A), human Rho GDIα transfected 293: sc-112194 (B) and Jurkat (C) whole cell lysates.
Rho GDIα (C-2): sc-374579. Immunoperoxidase staining of formalin fixed, paraffin-embedded human tonsil tissue showing cytoplasmic staining of cells in germinal and non-germinal centers.
Descargar