¡Bienvenido a Santa Cruz Biotechnology!

Dkk-1 Anticuerpo(B-7): sc-374574

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Dkk-1 Antibody (B-7) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-120 of Dkk-1 of human origin
  • recommended for detection of Dkk-1 of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para Dkk-1 con inmunógeno inidcado:
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Ver tambiénDkk AntibodiesincluyebdoDkk-4, Dkk-3, Dkk-2, Dkk-1yDkk.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Dkk-1 Antibody (B-7) sc-374574 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano DKK1 22943 10q21.1 NM_012242 O94907
605189
 


The Wnt genes are a group of well conserved, cysteine-rich secreted glycoproteins that are required for numerous developmental processes including embryogenesis, asymmetric cell division and central nervous system (CNS) patterning. Wnt association with the seven membrane spanning receptor frizzled activates dishevelled, which downregulates glycogen synthase kinase (GSK) through serine phosphorylation, causing the accumulation of b-catenin and subsequent regulation of developmentally significant Wnt |target genes. The Dickkopf family of secreted inhibitors of Wnt signaling ensures proper morphological development by antagonizing different stages of the Wnt cascade. Dkk-1 (Dickkopf-1) acts upstream of b-catenin and dishevelled to inhibit Wnt signaling. Dkk-1 is a 266-amino acid (human), secreted protein that contains a 31-residue N-terminal signal peptide, 2 cysteine rich domains, and a putative carboxy terminal N-glycosylation site. Human Dkk-1 transcripts are abundantly present in fetal kidney, adult placenta and adult prostate. Putative cis regulatory elements upstream of the Dkk-1 start site include p53, Sp1, MyoD, STAT, Oct-1/2, C/EBP-a, C/EBP-b, GATA-1, GATA-2 and GATA-3.

Dkk-1 Antibody (B-7) Data
Haga click en la imágen para agrandarla
Dkk-1 (B-7): sc-374574. Western blot analysis of human recombinant Dkk-1.
Dkk-1 (B-7): sc-374574. Immunoperoxidase staining of formalin fixed, paraffin-embedded human rectum tissue showing cytoplasmic staining of glandular cells.
Descargar