¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » ProteÍnas estructurales » SCGN Anticuerpos » SCGN Antibody (F-9): sc-374355

SCGN Anticuerpo(F-9): sc-374355

 |  Ficha Técnica

(Basado en el análisis de datos)

  • SCGN Antibody (F-9) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 186-276 mapping at the C-terminus of SCGN of human origin
  • recommended for detection of SCGN of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para SCGN con inmunógeno inidcado:
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Ver tambiénSCGN Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SCGN Antibody (F-9) sc-374355 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano SCGN 10590 6p22.2 NM_006998 O76038
 609202
 

SCGN, also known as Secretagogin, CALBL, setagin or SECRET, is a 276 amino acid cytoplasmic protein that contains six EF-hand domains and is related to the calicium-binding proteins Calretinin and Calbindin D28K. Expressed in a variety of tissues including stomach, thyroid, colon, brain and neuroendocrine cells, SCGN is thought to be involved in cell proliferation and KCl (potassium chloride)-mediated calcium flux events. Through its interaction with KCl and its subsequent ability to modulate calcium storage pools within the cell, SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication.
SCGN Antibody (F-9) Data
Haga click en la imágen para agrandarla
sc-374355
SCGN (F-9): sc-374355. Western blot analysis of SCGN expression in non-transfected: sc-117752 (A) and mouse SCGN transfected: sc-123383 (B) 293T whole cell lysates.
sc-374355
SCGN (F-9): sc-374355. Immunoperoxidase staining of formalin fixed, paraffin-embedded human pancreas tissue showing cytoplasmic and nuclear staining of Islets of Langerhans.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader