¡Bienvenido a Santa Cruz Biotechnology!

CA XII Anticuerpo(A-3): sc-374313

 |  Ficha Técnica

(Basado en el análisis de datos)

  • CA XII Antibody (A-3) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 241-354 of CA XII of human origin
  • recommended for detection of CA XII of human origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para CA XII con inmunógeno inidcado:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA

Ver tambiénCarbonic Anhydrases AntibodiesincluyebdoCarbonic Anhydrases, CA I, CA II, CA III, CA IV, CA IX, CA V, CA VB, CA VI, CA VII, CA VIII, CA X, CA XI, CA XII, CA XIII, CA XIVyCA XV.

También verCarbonic Anhydrases Inhibitors for functional analysis of cellular responses to Carbonic Anhydrases.


Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
CA XII Antibody (A-3) sc-374313 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano CA12 771 15q22.2 NM_001218, NM_206925 O43570
603263
Ratón Car12 76459 9 C NM_178396 Q8CI85
No Disponible
 


Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. CAs are involved in a variety of biological processes including respiration, calcification, acid-base balance and bone resorption, as well as the formation of aqueous humor, cerebrospinal fluid, saliva and gastric juice. They show extensive diversity in distribution and in their subcellular localization. The human CA2 gene, which maps to chromosome 8q21, encodes CA II, a cytoplasmic protein that has the highest turnover rate and widest tissue distribution of any known human CA isozyme. The human CA4 gene, which maps to chromosome 17q23, encodes CA IV, a membrane-anchored isozyme that is expressed on the luminal surfaces of pulmonary capillaries and proximal renal tubules. The human CA9, CA12 and CA14 genes, which map to chromosomes 9p13, 15q22 and 1q21, respectively, encode transmembrane proteins that have unique patterns of tissue-specific expression. CA IX is specifically expressed in clear-cell renal carcinomas, whereas CA XII is highly expressed in normal tissues, such as kidney, colon and pancreas. Human CA XIV is also expressed in normal tissues, such as brain, but differs from CA XII in its expression pattern.

CA XII Antibody (A-3) Data
Haga click en la imágen para agrandarla
CA XII (A-3): sc-374313. Western blot analysis of CA XII expression in MCF7 whole cell lysate.
Descargar