¡Bienvenido a Santa Cruz Biotechnology!

Annexin A9 Anticuerpo(F-9): sc-374288

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Annexin A9 Antibody (F-9) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 186-270 mapping within an internal region of Annexin A9 of human origin
  • recommended for detection of Annexin A9 of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para Annexin A9 con inmunógeno inidcado:
MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTNRSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAEGPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLHQALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM

Ver tambiénAnnexin AntibodiesincluyebdoAnnexin, Annexin I, Annexin II, Annexin III, Annexin IV, Annexin V, Annexin VI, Annexin VII, Annexin VIII, Annexin XI, Annexin A9, Annexin A10yAnnexin A13.

También verAnnexin Activators for functional analysis of cellular responses to Annexin.


Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Annexin A9 Antibody (F-9) sc-374288 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano ANXA9 8416 1q21.2 NM_003568 O76027
603319
Ratón Anxa9 71790 3 F2.1 NM_001085383, NM_023628 Q9JHQ0
No Disponible
 


The annexin family of calcium-binding proteins contains several family members that are characterized by a conserved core domain, which binds phospholipids in a Ca2+-dependent manner, and a unique amino-terminal region, which may confer binding specificity. Annexin family members have been implicated as regulators of diverse processes, such as ion flux, endocytosis, exocytosis and cellular adhesion. Annexin A9 (ANXA9), also known as Annexin-31 (ANX31) or Pemphaxin, is a 345 amino acid protein that contains four Annexin domains and may act as a low affinity receptor for acetylcholine. It is an atypical member of the annexin family because its intracellular activity is not subject to Ca(2+) regulation as a result of sequence mutations. Annexin A9 is one of the target proteins that is recognized by autoantibodies in patients with pemphigus vulgaris, a rare autoimmune skin condition in which blisters occur in the epidermis due to loss of cell-cell adhesion.

Annexin A9 Antibody (F-9) Data
Haga click en la imágen para agrandarla
Annexin A9 (F-9): sc-374288. Western blot analysis of Annexin A9 expression in non-transfected: sc-117752 (A) and mouse Annexin A9 transfected: sc-118427 (B) 293T whole cell lysates.
Annexin A9 (F-9): sc-374288. Immunoperoxidase staining of formalin fixed, paraffin-embedded human gall bladder tissue showing cytoplasmic and membrane staining of glandular cells.
Descargar