¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Intermediarios de Señal » MREG Anticuerpos » MREG Antibody (F-3): sc-374216

MREG Anticuerpo(F-3): sc-374216

 |  Ficha Técnica

(Basado en el análisis de datos)

  • MREG Antibody (F-3) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-214 representing full length MREG of human origin
  • recommended for detection of MREG of human origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para MREG con inmunógeno inidcado:
MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPS

Ver tambiénMREG Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MREG Antibody (F-3) sc-374216 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano MREG 55686 2q35 NM_018000 Q8N565
 609207
Ratón Mreg 381269 1 C3 NM_001005423 Q6NVG5
 No Disponible
 

The photoreceptor rod cell that is responsible for vision under conditions of low light consists of stacked arrays of disk membranes that make up its outer segment portion. Regulated by complex biochemical mechanisms, the rod outer segment is under constant renewal as new disks form at the base. MREG (melanoregulin), also known as DSU (dilute suppressor protein homolog) or WDT2, is thought to play a role in membrane fusion and in regulating the biogenesis of disk membranes of photoreceptor rods. MREG interacts with RDS (also known as Peripherin-2), a photoreceptor specific tetraspanin protein that is required to maintain normal cell structure during the renewal process of membrane fusion. MREG is 214 amino acids in length, is expressed in photoreceptor cells and and is expressed as two isoforms due to alternative splicing.

MREG Antibody (F-3) Data
Haga click en la imágen para agrandarla
sc-374216
MREG (F-3): sc-374216. Immunofluorescence staining of methanol-fixed HeLa cells showing membrane localization.
sc-374216
MREG (F-3): sc-374216. Western blot analysis of MREG expression in non-transfected 293T: sc-117752 (A), human MREG transfected 293T: sc-115293 (B) and MCF7 (C) whole cell lysates.
sc-374216
MREG (F-3): sc-374216. Western blot analysis of MREG expression in non-transfected 293T: sc-117752 (A), human MREG transfected 293T: sc-371309 (B), MCF7 (C), CCRF-CEM (D) and DU 145 (E) whole cell lysates.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader