¡Bienvenido a Santa Cruz Biotechnology!

ELOVL5 Anticuerpo(B-3): sc-374138

 |  Ficha Técnica

(Basado en el análisis de datos)

  • ELOVL5 Antibody (B-3) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 211-299 mapping at the C-terminus of ELOVL5 of human origin
  • recommended for detection of ELOVL5 of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para ELOVL5 con inmunógeno inidcado:
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Ver tambiénELOVL AntibodiesincluyebdoELOVL, ELOVL1, ELOVL2, ELOVL3, ELOVL4, ELOVL5, ELOVL6yELOVL7.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
ELOVL5 Antibody (B-3) sc-374138 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano ELOVL5 60481 6p12.1 NM_021814 Q9NYP7
n/a
 


Elongation of very long chain fatty acid-like (ELOVL) proteins 1-6 are members of the ELO family of proteins, which play an important role in tissue-specific biosynthesis of very long chain fatty acids and sphingolipids. The ELOVL proteins act as catalysts in fatty acid elongation reduction and localize to the endoplasmic reticulum (ER). Elongation of very long chain fatty acids protein 5 (ELOVL5), also known as HELO1 (human elongase 1), is predominantly expressed in adrenal gland and testis, but is also found in lung, brain and prostate tissue. ELOVL5 participates in the elongation of monounsaturated and polyunsaturated fatty acids of 18 to 20 carbons and thereby regulates the activity of PPARå. In addition, ELOVL5 localizes to the sebaceous glands of the pheromone-producing region of skin and may be associated with pheromone production and regulation.

ELOVL5 Antibody (B-3) Data
Haga click en la imágen para agrandarla
ELOVL5 (B-3): sc-374138. Western blot analysis of ELOVL5 expression in HeLa whole cell lysate.
ELOVL5 (B-3): sc-374138. Immunoperoxidase staining of formalin fixed, paraffin-embedded human breast tissue showing cytoplasmic and membrane staining of glandular cells.
Descargar