¡Bienvenido a Santa Cruz Biotechnology!

NANS Anticuerpo(D-8): sc-374132

 |  Ficha Técnica

(Basado en el análisis de datos)

  • NANS Antibody (D-8) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-300 mapping at the N-terminus of NANS of human origin
  • recommended for detection of NANS of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para NANS con inmunógeno inidcado:
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Ver tambiénNANS Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
NANS Antibody (D-8) sc-374132 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano NANS 54187 9q22.33 NM_018946 Q9NR45
605202
Ratón Nans 94181 4 B1 NM_053179 NP_444409
No Disponible
 


Sialic acids are a family of 9-carbon 2-keto-3-deoxy sugars that are found on the ends of glycoproteins and glycolipids and play important roles in recognition events within the cell. NANS (N-acetylneuraminic acid synthase), also known as SAS, is a 359 amino acid protein that contains one AFP (antifreeze proteins)-like domain and functions in the biosynthesis of sialic acids. Expressed ubiquitously, NANS enzymatically catalyzes the H2O-dependent formation of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), both of which are sialic acids. NANS uses N-acetylmannosamine 6-phosphate as a substrate for Neu5Ac synthesis and mannose 6-phosphate as a substrate for KDN synthesis. Human NANS shares 36% identity with the E. coli protein neuB, suggesting a conserved function between species.

NANS Antibody (D-8) Data
Haga click en la imágen para agrandarla
NANS (D-8): sc-374132. Western blot analysis of NANS expression in HeLa (A) and PC-3 (B) whole cell lysates.
NANS (D-8): sc-374132. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear and cytoplasmic localization.
NANS (D-8): sc-374132. Immunoperoxidase staining of formalin fixed, paraffin-embedded human rectum tissue showing nuclear and cytoplasmic staining of glandular cells.
Descargar