¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Intermediarios de Señal » Semenogelin Anticuerpos » Semenogelin-1/2 Antibody (H-300): sc-33819

Semenogelin-1/2 Anticuerpo(H-300): sc-33819

 |  Ficha Técnica

(Basado en el análisis de datos)
  • Semenogelin-1/2 Antibody (H-300) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-300 mapping at the N-terminus of Semenogelin-1 of human origin
  • recommended for detection of Semenogelin-1 precursor, α-inhibin 31, α-inhibin 92 and Semenogelin-2 of human origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para Semenogelin-1/2 con inmunógeno inidcado:
MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHGENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT

Ver tambiénSemenogelin AntibodiesincluyebdoSemenogelin, Semenogelin-1ySemenogelin-2.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Semenogelin-1/2 Antibody (H-300) sc-33819 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano SEMG1 6406 20q13.12 NM_003007, NM_198139 P04279
 182140
 

Semenogelin, secreted high molecular weight seminal vesicle (HMV-SC) proteins, are the predominant protein found in semen. Semenogelin-1 and Semenogelin-2 are digested by PSA (prostate-specific antigen) in semen which leads to liquefaction and release of motile spermatozoa. Semenogelin-1 is a natural substrate of PSA. The Semenogelin precursor is processed to produce alpha-inhibin 31 and alpha-inhibin 92 active peptides. Semenogelin is involved in the formation of the gel matrix that encases ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins contribute to sperm movement activation. Semenogelin can form a complex with Eppin, an epididymal protease inhibitor. This complex of eppin and semenogelin can provide antimicrobial activity for spermatozoa. It can also provide for the preparation and survival of spermatozoa for fertility in the female reproductive tract. The genes encoding the two semenogelin proteins are found in a cluster on chromosome 20.