¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Sintesis y Degradación » GSTM Anticuerpos » GSTM Antibody (FL-218): sc-292368

GSTM Anticuerpo(FL-218): sc-292368

 |  Ficha Técnica

(Basado en el análisis de datos)

  • GSTM Antibody (FL-218) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-218 representing full length GSTM2 of human origin
  • recommended for detection of GSTM1, GSTM2, GSTM3, GSTM4 and GSTM5 of mouse, rat and human origin and Gstm6 and Gstm7 of mouse and rat origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para GSTM con inmunógeno inidcado:
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGN

Ver tambiénGSTM AntibodiesincluyebdoGSTM, GSTM1, Gstm6, Gstm7, GSTM2, GSTM3, GSTM4yGSTM5.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GSTM Antibody (FL-218) sc-292368 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano GSTM1 2944 1p13.3 NM_000561, NM_146421 P09488
 138350
Humano GSTM2 2946 1p13.3 NM_000848, NM_001142368 P28161
 138380
Humano GSTM3 2947 1p13.3 NM_000849 P21266
 138390
Humano GSTM4 2948 1p13.3 NM_000850, NM_147148 Q03013
 138333
Humano GSTM5 2949 1p13.3 NM_000851 P46439
 138385
Ratón Gstm1 14862 3 F2.3 NM_010358 P10649
 No Disponible
Ratón Gstm2 14863 3 F2.3 NM_008183 P15626
 No Disponible
Ratón Gstm3 14864 3 F2.3 NM_010359 P19639
 No Disponible
Ratón Gstm4 14865 3 F2.3 NM_001160411, NM_026764 NP_081040
 No Disponible
Ratón Gstm5 14866 3 F2.3 NM_010360 P48774
 No Disponible
Ratón Gstm6 14867 3 F2.3 NM_008184 O35660
 No Disponible
Ratón Gstm7 68312 3 F2.3 NM_026672 Q80W21
 No Disponible
 

Members of the glutathione S-transferase (GST) family of proteins function in the detoxification of xenobiotics to protect cells against toxicant-induced damage. There are eight families of GST proteins, namely alpha, zeta, theta, kappa, mu, pi, sigma and omega, each of which are composed of proteins that have a variety of functions throughout the cell. The GSTM proteins (GSTM1-GSTM5 in human and GSTM1-GSTM7 in mouse) are members of the mu class of enzymes that conjugate with glutathione and function in the detoxification of carcinogens, environmental toxins and products of oxidative stress. GSTM3 is a 225 amino acid protein that is expressed in the testis and brain. Localized to the cytoplasm, GSTM3 exists as a homodimer.

GSTM Antibody (FL-218) Data
Haga click en la imágen para agrandarla
sc-292368
GSTM (FL-218): sc-292368. Western blot analysis of GSTM expression in A-673 whole cell lysate.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader