¡Bienvenido a Santa Cruz Biotechnology!

Mts1 Anticuerpo(H-58): sc-292281

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Mts1 Antibody (H-58) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 44-101 mapping at the C-terminus of Mts1 of human origin
  • recommended for detection of Mts1 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Secuencia completa de la proteína para Mts1 con inmunógeno inidcado:
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Ver tambiénMts1 Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Mts1 Antibody (H-58) sc-292281 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano S100A4 6275 1q21.3 NM_002961, NM_019554 P26447
114210
 


The Mts1 gene encodes a small acidic Ca2+-binding protein, Mts1 (also designated S100A4, calvasculin or metastasin). Mts1 belongs to the S100 family of small Ca2+-binding proteins and is expressed in a cell-specific manner. Mts1 protein is involved in tumor progression and metastasis, and also has a significant stimulatory effect on angiogenesis. The level of Mts1 protein in serum increases with aging, suggesting that Mts1 may play a role in the ind-uction of tumor progression via stimulation of angiogenesis. In addition, Mts1 cooperates with p53 in apoptosis induction by binding to the C-term-inal regulatory domain of p53 to inhibit the DNA binding activity of p53. The ability of Mts1 to enhance p53-dependent apoptosis may accelerate the loss of p53 function in tumors. Thus, Mts1 can contribute to the development of a more aggressive phenotype during tumor progression.

Mts1 Antibody (H-58) Data
Haga click en la imágen para agrandarla
Mts1 (H-58): sc-292281. Western blot analysis of human recombinant Mts1 fusion protein.
Descargar